DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cdk4 and CAK1

DIOPT Version :9

Sequence 1:NP_001286493.1 Gene:Cdk4 / 36854 FlyBaseID:FBgn0016131 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_116624.1 Gene:CAK1 / 850515 SGDID:S000001865 Length:368 Species:Saccharomyces cerevisiae


Alignment Length:253 Identity:69/253 - (27%)
Similarity:115/253 - (45%) Gaps:69/253 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 PMSTLREISLLKQL-NASNHANIVKLYEVCQFLERDGQLLILLVFEHVEQDLSDLI------DRL 124
            |.:...|:|:|.:| |...|  |:.|.|  .....:..||:|..||  |.:|.:.:      ||.
Yeast    41 PHNAKFEVSILNKLGNKCKH--ILPLLE--SKATDNNDLLLLFPFE--EMNLYEFMQMHYKRDRR 99

  Fly   125 PKSG-----------MSPPTIQRLS-------------RELLTGVDFLHSHRIIHRDLKPQNLLV 165
            .|:.           ::.|.:|:.:             |:::.|:.|||.::|||||:||||:::
Yeast   100 KKNPYYDLLNPSIPIVADPPVQKYTNQLDVNRYSLSFFRQMVEGIAFLHENKIIHRDIKPQNIML 164

  Fly   166 SS-----QGHLKIADFGL-------AKTYGSEM--KLTSVVVTLWYRAPEVLL-AQPYNSTVDIW 215
            ::     ...|.|.|||:       ::|....|  |:|.:...: |:|||||. .:.|:..||:|
Yeast   165 TNNTSTVSPKLYIIDFGISYDMANNSQTSAEPMDSKVTDISTGI-YKAPEVLFGVKCYDGGVDVW 228

  Fly   216 SAACIIFEMFNRRA---------LFPGTSEKNQ-------LDRIFELTGRPTEQQWPQ 257
            |...||.:.|.|..         :..|:.:.|.       :..|||..|.|:.|:|.:
Yeast   229 SLLIIISQWFQRETSRMGHVPAMIDDGSDDMNSDGSDFRLICSIFEKLGIPSIQKWEE 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cdk4NP_001286493.1 STKc_CDK4_6_like 26..312 CDD:270831 69/253 (27%)
S_TKc 26..312 CDD:214567 69/253 (27%)
CAK1NP_116624.1 PKc_like 13..>234 CDD:419665 56/199 (28%)
PKc_like <135..363 CDD:419665 47/153 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0594
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.