DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cdk4 and CDKB2;2

DIOPT Version :9

Sequence 1:NP_001286493.1 Gene:Cdk4 / 36854 FlyBaseID:FBgn0016131 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_173517.1 Gene:CDKB2;2 / 838687 AraportID:AT1G20930 Length:315 Species:Arabidopsis thaliana


Alignment Length:297 Identity:133/297 - (44%)
Similarity:183/297 - (61%) Gaps:8/297 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 YQELNIIGEGAYGTVYRARDVITGNIVALKKVRISLNENGVPMSTLREISLLKQLNASNHANIVK 90
            :::|..:|||.||.|||||:..||.||||||.|:..:|.|||.:||||||:|:.|....|  ||:
plant    16 FEKLEKVGEGTYGKVYRAREKATGMIVALKKTRLHEDEEGVPPTTLREISILRMLARDPH--IVR 78

  Fly    91 LYEVCQFLERDGQLLILLVFEHVEQDLSDLIDRLPKSGMSPP--TIQRLSRELLTGVDFLHSHRI 153
            |.:|.|.:.::|:.::.||||:|:.||...|....::|.:.|  |::.|..:|..|:.|.|.|.:
plant    79 LMDVKQGINKEGKTVLYLVFEYVDTDLKKFIRSFRQAGQNIPQNTVKCLMYQLCKGMAFCHGHGV 143

  Fly   154 IHRDLKPQNLLVSSQG-HLKIADFGLAKTYGSEM-KLTSVVVTLWYRAPEVLL-AQPYNSTVDIW 215
            :||||||.|||:..:. .|||||.|||:.:...| |.|..::||||||||||| |..|::.||:|
plant   144 LHRDLKPHNLLMDRKTMTLKIADLGLARAFTLPMKKYTHEILTLWYRAPEVLLGATHYSTGVDMW 208

  Fly   216 SAACIIFEMFNRRALFPGTSEKNQLDRIFELTGRPTEQQWPQTISVALEH-FPQRHPKRPKDFCP 279
            |..||..|:..::|:|.|.||..||.|||.|.|.|.|:.||....:...| :||..|.......|
plant   209 SVGCIFAELVTKQAIFAGDSELQQLLRIFRLLGTPNEEVWPGVSKLKDWHEYPQWKPLSLSTAVP 273

  Fly   280 HLCKYADDLLNKMLSYDLHLRPSALACLEHDYFQQEP 316
            :|.:...|||:|||.|:...|.||...:||.||...|
plant   274 NLDEAGLDLLSKMLEYEPAKRISAKKAMEHPYFDDLP 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cdk4NP_001286493.1 STKc_CDK4_6_like 26..312 CDD:270831 130/291 (45%)
S_TKc 26..312 CDD:214567 130/291 (45%)
CDKB2;2NP_173517.1 PKc_like 14..307 CDD:389743 131/292 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0594
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24056
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.