DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Cdk4 and ORG1

DIOPT Version :9

Sequence 1:	NP_001286493.1	Gene:	Cdk4 / 36854	FlyBaseID:	FBgn0016131	Length:	317	Species:	Drosophila melanogaster
Sequence 2:	NP_851182.1	Gene:	ORG1 / 835426	AraportID:	AT5G53450	Length:	670	Species:	Arabidopsis thaliana

Alignment Length:	58	Identity:	20/58 - (34%)
Similarity:	36/58 - (62%)	Gaps:	1/58 - (1%)

- Green bases have known domain annotations that are detailed below.

  Fly   134 IQRLSRELLTGVDFLHSHRIIHRDLKPQNLLVSS-QGHLKIADFGLAKTYGSEMKLTS 190
            |:.|.|::|.||::||||.:.|.:|:.:|:.:|. ..|:|:...|.|..:..::..||
plant   232 IRTLMRDILIGVNYLHSHGLAHTELRLENVHISPVDRHIKVGILGNAADFNGDVPSTS 289

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Cdk4	NP_001286493.1	STKc_CDK4_6_like	26..312	CDD:270831	20/58 (34%)
Cdk4	NP_001286493.1	S_TKc	26..312	CDD:214567	20/58 (34%)
ORG1	NP_851182.1	PKc_like	106..399	CDD:419665	20/58 (34%)
ORG1	NP_851182.1	PAP_fibrillin	434..587	CDD:309752
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_KOG0594
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.900