DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cdk4 and CDKB1;1

DIOPT Version :9

Sequence 1:NP_001286493.1 Gene:Cdk4 / 36854 FlyBaseID:FBgn0016131 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_190986.1 Gene:CDKB1;1 / 824585 AraportID:AT3G54180 Length:309 Species:Arabidopsis thaliana


Alignment Length:305 Identity:136/305 - (44%)
Similarity:178/305 - (58%) Gaps:25/305 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 YQELNIIGEGAYGTVYRARDVITGNIVALKKVRISLNENGVPMSTLREISLLKQLNASNHANIVK 90
            |::|..:|||.||.||:|.:..||.:|||||.|:.::|.|:|.:.|||||||:.|:.|.:  :|:
plant     4 YEKLEKVGEGTYGKVYKAMEKGTGKLVALKKTRLEMDEEGIPPTALREISLLQMLSTSIY--VVR 66

  Fly    91 LYEVC-------QFLERDGQLLILLVFEHVEQDLSDLIDRLPK----SGMSPPTIQRLSRELLTG 144
            |  :|       ....:..:..:.||||:::.||...||...|    ..:.|..||:|..:|..|
plant    67 L--LCVEHVHQPSTKSQSTKSNLYLVFEYLDTDLKKFIDSYRKGPNPKPLEPFLIQKLMFQLCKG 129

  Fly   145 VDFLHSHRIIHRDLKPQN-LLVSSQGHLKIADFGLAKTYGSEMK-LTSVVVTLWYRAPEVLLAQP 207
            |...|||.::|||||||| |||..:..|||||.||.:.:...:| .|..:||||||||||||...
plant   130 VAHCHSHGVLHRDLKPQNLLLVKDKELLKIADLGLGRAFTVPLKSYTHEIVTLWYRAPEVLLGST 194

  Fly   208 YNST-VDIWSAACIIFEMFNRRALFPGTSEKNQLDRIFELTGRPTEQQWPQTISVALEHFPQRHP 271
            :.|| ||:||..||..||..|:|||||.||..||..||.|.|.|||||||...::...|.   :|
plant   195 HYSTGVDMWSVGCIFAEMVRRQALFPGDSEFQQLLHIFRLLGTPTEQQWPGVSTLRDWHV---YP 256

  Fly   272 K-RPKDF---CPHLCKYADDLLNKMLSYDLHLRPSALACLEHDYF 312
            | .|:|.   .|.|.....|||.|||.|:...|.||...|:|.||
plant   257 KWEPQDLTLAVPSLSPQGVDLLTKMLKYNPAERISAKTALDHPYF 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cdk4NP_001286493.1 STKc_CDK4_6_like 26..312 CDD:270831 134/303 (44%)
S_TKc 26..312 CDD:214567 134/303 (44%)
CDKB1;1NP_190986.1 PKc_like 2..302 CDD:419665 136/305 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0594
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24056
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.