DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cdk4 and CDKB1;2

DIOPT Version :9

Sequence 1:NP_001286493.1 Gene:Cdk4 / 36854 FlyBaseID:FBgn0016131 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_001031507.1 Gene:CDKB1;2 / 818444 AraportID:AT2G38620 Length:311 Species:Arabidopsis thaliana


Alignment Length:302 Identity:134/302 - (44%)
Similarity:179/302 - (59%) Gaps:17/302 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 YQELNIIGEGAYGTVYRARDVITGNIVALKKVRISLNENGVPMSTLREISLLKQLNASNHANIVK 90
            |::|..:|||.||.||:|.:..||.:|||||.|:.::|.|:|.:.|||||||:.|:.|.:  ||:
plant     4 YEKLEKVGEGTYGKVYKAMEKTTGKLVALKKTRLEMDEEGIPPTALREISLLQMLSQSIY--IVR 66

  Fly    91 LYEVCQFLERDGQLL-------ILLVFEHVEQDLSDLIDRLPKSGMSPP----TIQRLSRELLTG 144
            |..|...::.....:       :.||||:::.||...||...|.....|    .:||...:|..|
plant    67 LLCVEHVIQSKDSTVSHSPKSNLYLVFEYLDTDLKKFIDSHRKGSNPRPLEASLVQRFMFQLFKG 131

  Fly   145 VDFLHSHRIIHRDLKPQNLLV-SSQGHLKIADFGLAKTYGSEMK-LTSVVVTLWYRAPEVLLAQP 207
            |...|||.::||||||||||: ..:|.|||||.||::.:...:| .|..:||||||||||||...
plant   132 VAHCHSHGVLHRDLKPQNLLLDKDKGILKIADLGLSRAFTVPLKAYTHEIVTLWYRAPEVLLGST 196

  Fly   208 -YNSTVDIWSAACIIFEMFNRRALFPGTSEKNQLDRIFELTGRPTEQQWPQTISVALEH-FPQRH 270
             |::.|||||..||..||..|:|||||.||..||..||.|.|.|||||||..:::...| :|:..
plant   197 HYSTAVDIWSVGCIFAEMIRRQALFPGDSEFQQLLHIFRLLGTPTEQQWPGVMALRDWHVYPKWE 261

  Fly   271 PKRPKDFCPHLCKYADDLLNKMLSYDLHLRPSALACLEHDYF 312
            |:......|.|.....|||.:||.|:...|.||.|.|:|.||
plant   262 PQDLSRAVPSLSPEGIDLLTQMLKYNPAERISAKAALDHPYF 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cdk4NP_001286493.1 STKc_CDK4_6_like 26..312 CDD:270831 132/300 (44%)
S_TKc 26..312 CDD:214567 132/300 (44%)
CDKB1;2NP_001031507.1 PLN00009 1..306 CDD:177649 134/302 (44%)
STKc_CdkB_plant 2..304 CDD:270830 134/302 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0594
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24056
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.