DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cdk4 and cdk15

DIOPT Version :9

Sequence 1:NP_001286493.1 Gene:Cdk4 / 36854 FlyBaseID:FBgn0016131 Length:317 Species:Drosophila melanogaster
Sequence 2:XP_005165792.1 Gene:cdk15 / 791619 ZFINID:ZDB-GENE-060421-7193 Length:461 Species:Danio rerio


Alignment Length:350 Identity:122/350 - (34%)
Similarity:178/350 - (50%) Gaps:60/350 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 QLKRQKMSQAKKFGD-------------------GDPFNYQELNIIGEGAYGTVYRARDVITGNI 51
            |::|.::.:.:...|                   |:..:|..|..:|||.|.|||:....|.|::
Zfish    88 QVRRLRVQRGRSNSDPMGGKSFQQEFQWKTGLQFGNATSYLNLEKLGEGTYATVYKGISRINGHL 152

  Fly    52 VALKKVRISLNENGVPMSTLREISLLKQLNASNHANIVKLYEVCQFLERDGQLLILLVFEHVEQD 116
            ||||.:.:. .|.|:|.:.:||.||||.|   .|||||.|:::....|.     :..|||:|:.|
Zfish   153 VALKVIHMK-TEEGIPFTAIREASLLKGL---KHANIVLLHDIIHTRES-----LTFVFEYVQTD 208

  Fly   117 LSDLIDRLPKSGMSPPTIQRLSRELLTGVDFLHSHRIIHRDLKPQNLLVSSQGHLKIADFGLAK- 180
            |:..:.:.| .|:....|:....:||.|:.::|..||:||||||||||:|..|.||:||||||: 
Zfish   209 LAQYMIQHP-GGLHSYNIRLFMFQLLRGLSYIHGRRILHRDLKPQNLLISYLGELKLADFGLARS 272

  Fly   181 ------TYGSEMKLTSVVVTLWYRAPEVLL-AQPYNSTVDIWSAACIIFEMFNRRALFPGTSEK- 237
                  ||.:|      |||||||.|:||: :..|::.:|||.|.||..||......|||.::. 
Zfish   273 KSIPCQTYSAE------VVTLWYRPPDVLMGSTDYSTALDIWGAGCIFIEMLQGSPAFPGVADVF 331

  Fly   238 NQLDRIFELTGRPTEQQWPQTISVALEHFPQRHPK-----RPKDF------CPHLCKYADDLLNK 291
            .||.:|:.:.|.|||:.||     .:...|...|:     :|:.|      ...|....:||..:
Zfish   332 EQLLKIWTVIGVPTEEIWP-----GVSDLPNYKPEWFLPCKPQQFRDVWKRLSQLPYKTEDLAQQ 391

  Fly   292 MLSYDLHLRPSALACLEHDYFQQEP 316
            ||..:...|.||...|.|.||...|
Zfish   392 MLMMNPKDRISAQDALLHPYFNTLP 416

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cdk4NP_001286493.1 STKc_CDK4_6_like 26..312 CDD:270831 115/305 (38%)
S_TKc 26..312 CDD:214567 115/305 (38%)
cdk15XP_005165792.1 STKc_PFTAIRE2 126..412 CDD:270852 115/306 (38%)
PLN00009 127..415 CDD:177649 117/308 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0594
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.