DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cdk4 and cdk5

DIOPT Version :9

Sequence 1:NP_001286493.1 Gene:Cdk4 / 36854 FlyBaseID:FBgn0016131 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_571794.1 Gene:cdk5 / 65234 ZFINID:ZDB-GENE-010131-2 Length:292 Species:Danio rerio


Alignment Length:295 Identity:131/295 - (44%)
Similarity:181/295 - (61%) Gaps:20/295 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 YQELNIIGEGAYGTVYRARDVITGNIVALKKVRISLNENGVPMSTLREISLLKQLNASNHANIVK 90
            |::|..||||.||||::|::..|..|||||:||:..::.|||.|.||||.|||:|   .|.|||:
Zfish     4 YEKLEKIGEGTYGTVFKAKNRETHEIVALKRVRLDDDDEGVPSSALREICLLKEL---KHKNIVR 65

  Fly    91 LYEVCQFLERDGQLLILLVFEHVEQDLSDLIDRLPKSGMSPPTIQRLSRELLTGVDFLHSHRIIH 155
            |::|   |..|.:|  .||||:.:|||....|.. ...:.|..::....:||.|:.|.||..::|
Zfish    66 LHDV---LHSDKKL--TLVFEYCDQDLKKYFDSC-NGDLDPEIVKSFMYQLLKGLAFCHSRNVLH 124

  Fly   156 RDLKPQNLLVSSQGHLKIADFGLAKTYGSEMKLTSV-VVTLWYRAPEVLL-AQPYNSTVDIWSAA 218
            |||||||||::..|.||:||||||:.:|..::..|. |||||||.|:||. |:.|::::|:|||.
Zfish   125 RDLKPQNLLINRNGELKLADFGLARAFGIPVRCYSAEVVTLWYRPPDVLFGAKLYSTSIDMWSAG 189

  Fly   219 CIIFEMFNR-RALFPGTSEKNQLDRIFELTGRPTEQQWPQTISVALEHFPQRHPKRPK-----DF 277
            ||..|:.|. |.||||....:||.|||.|.|.|||:|| ||::...::.|  :|..|.     :.
Zfish   190 CIFAELANAGRPLFPGNDVDDQLKRIFRLLGTPTEEQW-QTMNKLPDYKP--YPMYPATTSLVNV 251

  Fly   278 CPHLCKYADDLLNKMLSYDLHLRPSALACLEHDYF 312
            .|.|.....|||..:|..:...|.||...|:|.||
Zfish   252 VPKLSSTGRDLLQNLLKCNPVQRISAEEALQHPYF 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cdk4NP_001286493.1 STKc_CDK4_6_like 26..312 CDD:270831 129/293 (44%)
S_TKc 26..312 CDD:214567 129/293 (44%)
cdk5NP_571794.1 STKc_CDK5 3..286 CDD:143344 129/293 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.