DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cdk4 and CDK15

DIOPT Version :9

Sequence 1:NP_001286493.1 Gene:Cdk4 / 36854 FlyBaseID:FBgn0016131 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_001353315.1 Gene:CDK15 / 65061 HGNCID:14434 Length:435 Species:Homo sapiens


Alignment Length:330 Identity:131/330 - (39%)
Similarity:176/330 - (53%) Gaps:46/330 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 RQKMSQAKKFGDGDPFNYQELNIIGEGAYGTVYRARDVITGNIVALKKVRISLN-ENGVPMSTLR 72
            ||.....|....|...:|..|..:|||:|.|||:....|.|.:||||.  ||:| |.|||.:.:|
Human    86 RQGFQWRKSLPFGAASSYLNLEKLGEGSYATVYKGISRINGQLVALKV--ISMNAEEGVPFTAIR 148

  Fly    73 EISLLKQLNASNHANIVKLYEVCQFLERDGQLLILLVFEHVEQDLSDLIDRLPKSGMSPPTIQRL 137
            |.||||.|   .|||||.|:::....|     .:..|||::..||:..:.:.| .|:.|..::..
Human   149 EASLLKGL---KHANIVLLHDIIHTKE-----TLTFVFEYMHTDLAQYMSQHP-GGLHPHNVRLF 204

  Fly   138 SRELLTGVDFLHSHRIIHRDLKPQNLLVSSQGHLKIADFGLAK-------TYGSEMKLTSVVVTL 195
            ..:||.|:.::|...::||||||||||:|..|.||:||||||:       ||.||      ||||
Human   205 MFQLLRGLAYIHHQHVLHRDLKPQNLLISHLGELKLADFGLARAKSIPSQTYSSE------VVTL 263

  Fly   196 WYRAPEVLL-AQPYNSTVDIWSAACIIFEMFNRRALFPGTSE-KNQLDRIFELTGRPTEQQWPQT 258
            |||.|:.|| |..|:|.:|||.|.||..|||..:.||||.|. ..||::|:|:.|.|||..||  
Human   264 WYRPPDALLGATEYSSELDIWGAGCIFIEMFQGQPLFPGVSNILEQLEKIWEVLGVPTEDTWP-- 326

  Fly   259 ISVALEHFPQRHPK-----RPKDFCPHL-------CKYADDLLNKMLSYDLHLRPSALACLEHDY 311
               .:...|..:|:     .|:..  |:       ...|:||.::||......|.||...|.|||
Human   327 ---GVSKLPNYNPEWFPLPTPRSL--HVVWNRLGRVPEAEDLASQMLKGFPRDRVSAQEALVHDY 386

  Fly   312 FQQEP 316
            |...|
Human   387 FSALP 391

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cdk4NP_001286493.1 STKc_CDK4_6_like 26..312 CDD:270831 124/307 (40%)
S_TKc 26..312 CDD:214567 124/307 (40%)
CDK15NP_001353315.1 STKc_PFTAIRE2 102..387 CDD:270852 124/308 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0594
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.