DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cdk4 and CDK14

DIOPT Version :9

Sequence 1:NP_001286493.1 Gene:Cdk4 / 36854 FlyBaseID:FBgn0016131 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_001274064.1 Gene:CDK14 / 5218 HGNCID:8883 Length:469 Species:Homo sapiens


Alignment Length:335 Identity:130/335 - (38%)
Similarity:183/335 - (54%) Gaps:48/335 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 VRQLKRQKMSQAKKFGDGDPFNYQELNIIGEGAYGTVYRARDVITGNIVALKKVRISLNENGVPM 68
            ||:........:.|||..|  :|::|..:|||:|.|||:.:..:.|.:||||.:|:. .|.|.|.
Human   115 VRRHSSPSSPTSPKFGKAD--SYEKLEKLGEGSYATVYKGKSKVNGKLVALKVIRLQ-EEEGTPF 176

  Fly    69 STLREISLLKQLNASNHANIVKLYEVCQFLERDGQLLILLVFEHVEQDLSDLIDRLPKSGMSPPT 133
            :.:||.||||.|   .|||||.|:::....|     .:.||||:|..||...:|:.| .|:.|..
Human   177 TAIREASLLKGL---KHANIVLLHDIIHTKE-----TLTLVFEYVHTDLCQYMDKHP-GGLHPDN 232

  Fly   134 IQRLSRELLTGVDFLHSHRIIHRDLKPQNLLVSSQGHLKIADFGLAK-------TYGSEMKLTSV 191
            ::....:||.|:.::|...|:||||||||||:|..|.||:||||||:       ||.:|      
Human   233 VKLFLFQLLRGLSYIHQRYILHRDLKPQNLLISDTGELKLADFGLARAKSVPSHTYSNE------ 291

  Fly   192 VVTLWYRAPEVLL-AQPYNSTVDIWSAACIIFEMFNRRALFPGTSE-KNQLDRIFELTGRPTEQQ 254
            |||||||.|:||| :..|::.:|:|...||..||....|.|||..: ::||:|||.:.|.|.|..
Human   292 VVTLWYRPPDVLLGSTEYSTCLDMWGVGCIFVEMIQGVAAFPGMKDIQDQLERIFLVLGTPNEDT 356

  Fly   255 WPQTISVALEHFPQRHPKRPKDFCPHLCK-------------YADDLLNKMLSYDLHLRPSALAC 306
            ||...|  |.||      :|:.|..:..|             :|:||.:|:|......|.||.|.
Human   357 WPGVHS--LPHF------KPERFTLYSSKNLRQAWNKLSYVNHAEDLASKLLQCSPKNRLSAQAA 413

  Fly   307 LEHDYFQQEP 316
            |.|:||...|
Human   414 LSHEYFSDLP 423

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cdk4NP_001286493.1 STKc_CDK4_6_like 26..312 CDD:270831 121/307 (39%)
S_TKc 26..312 CDD:214567 121/307 (39%)
CDK14NP_001274064.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 103..133 5/17 (29%)
STKc_PFTAIRE1 129..431 CDD:143374 127/321 (40%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 449..469
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0594
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.