DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cdk4 and CDK18

DIOPT Version :9

Sequence 1:NP_001286493.1 Gene:Cdk4 / 36854 FlyBaseID:FBgn0016131 Length:317 Species:Drosophila melanogaster
Sequence 2:XP_016856912.1 Gene:CDK18 / 5129 HGNCID:8751 Length:572 Species:Homo sapiens


Alignment Length:325 Identity:129/325 - (39%)
Similarity:183/325 - (56%) Gaps:40/325 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 RQLKRQKMSQAKKFGDGDPFNYQELNIIGEGAYGTVYRARDVITGNIVALKKVRISLNENGVPMS 69
            |..:|..:|.   .|.|....|.:|:.:|||.|.||::.|..:|.|:||||::|:. :|.|.|.:
Human   224 RMSRRASLSD---IGFGKLETYVKLDKLGEGTYATVFKGRSKLTENLVALKEIRLE-HEEGAPCT 284

  Fly    70 TLREISLLKQLNASNHANIVKLYEVCQFLERDGQLLILLVFEHVEQDLSDLIDRLPKSGMSPPTI 134
            .:||:||||.|   .|||||.|:::   :..|..|  .||||:::.||...:|..... ||...:
Human   285 AIREVSLLKNL---KHANIVTLHDL---IHTDRSL--TLVFEYLDSDLKQYLDHCGNL-MSMHNV 340

  Fly   135 QRLSRELLTGVDFLHSHRIIHRDLKPQNLLVSSQGHLKIADFGLA-------KTYGSEMKLTSVV 192
            :....:||.|:.:.|..:|:||||||||||::.:|.||:||||||       |||.:|      |
Human   341 KIFMFQLLRGLAYCHHRKILHRDLKPQNLLINERGELKLADFGLARAKSVPTKTYSNE------V 399

  Fly   193 VTLWYRAPEVLL-AQPYNSTVDIWSAACIIFEMFNRRALFPGTSEKNQLDRIFELTGRPTEQQWP 256
            ||||||.|:||| :..|::.:|:|...||.:||...|.||||::.|.:|..||.|.|.|||:.||
Human   400 VTLWYRPPDVLLGSTEYSTPIDMWGVGCIHYEMATGRPLFPGSTVKEELHLIFRLLGTPTEETWP 464

  Fly   257 --------QTISVALEHFPQRHPKRPKDFCPHLCKYADDLLNKMLSYDLHLRPSALACLEHDYFQ 313
                    :|.|     ||...|:...:..|.|......||:.:|.|:...|.||.|.|.|.||:
Human   465 GVTAFSEFRTYS-----FPCYLPQPLINHAPRLDTDGIHLLSSLLLYESKSRMSAEAALSHSYFR 524

  Fly   314  313
            Human   525  524

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cdk4NP_001286493.1 STKc_CDK4_6_like 26..312 CDD:270831 122/301 (41%)
S_TKc 26..312 CDD:214567 122/301 (41%)
CDK18XP_016856912.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0594
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.