DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cdk4 and CDK17

DIOPT Version :9

Sequence 1:NP_001286493.1 Gene:Cdk4 / 36854 FlyBaseID:FBgn0016131 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_001163935.1 Gene:CDK17 / 5128 HGNCID:8750 Length:523 Species:Homo sapiens


Alignment Length:318 Identity:123/318 - (38%)
Similarity:187/318 - (58%) Gaps:29/318 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 KRQKMSQAKKFGDGDPFNYQELNIIGEGAYGTVYRARDVITGNIVALKKVRISLNENGVPMSTLR 72
            :|.:.:...:.|.|....|.:|..:|||.|.|||:.|..:|.|:||||::|:. :|.|.|.:.:|
Human   174 RRSRRASLSEIGFGKMETYIKLEKLGEGTYATVYKGRSKLTENLVALKEIRLE-HEEGAPCTAIR 237

  Fly    73 EISLLKQLNASNHANIVKLYEVCQFLERDGQLLILLVFEHVEQDLSDLIDRLPKSGMSPPTIQRL 137
            |:||||.|   .|||||.|:::   :..|..|  .||||::::||...:|..... ||...::..
Human   238 EVSLLKDL---KHANIVTLHDI---VHTDKSL--TLVFEYLDKDLKQYMDDCGNI-MSMHNVKLF 293

  Fly   138 SRELLTGVDFLHSHRIIHRDLKPQNLLVSSQGHLKIADFGLA-------KTYGSEMKLTSVVVTL 195
            ..::|.|:.:.|..:::||||||||||::.:|.||:||||||       |||.:|      ||||
Human   294 LYQILRGLAYCHRRKVLHRDLKPQNLLINEKGELKLADFGLARAKSVPTKTYSNE------VVTL 352

  Fly   196 WYRAPEVLL-AQPYNSTVDIWSAACIIFEMFNRRALFPGTSEKNQLDRIFELTGRPTEQQWPQTI 259
            |||.|:||| :..|::.:|:|...||.|||.:.|.||||::.:::|..||.|.|.|:::.|| .|
Human   353 WYRPPDVLLGSSEYSTQIDMWGVGCIFFEMASGRPLFPGSTVEDELHLIFRLLGTPSQETWP-GI 416

  Fly   260 SVALE----HFPQRHPKRPKDFCPHLCKYADDLLNKMLSYDLHLRPSALACLEHDYFQ 313
            |...|    :||:..|:...:..|.|.....:|:.|.|.|:...|.||...::|.||:
Human   417 SSNEEFKNYNFPKYKPQPLINHAPRLDSEGIELITKFLQYESKKRVSAEEAMKHVYFR 474

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cdk4NP_001286493.1 STKc_CDK4_6_like 26..312 CDD:270831 118/297 (40%)
S_TKc 26..312 CDD:214567 118/297 (40%)
CDK17NP_001163935.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 30..55
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 103..123
STKc_PCTAIRE2 185..493 CDD:143377 122/307 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0594
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.