DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cdk4 and CG6800

DIOPT Version :9

Sequence 1:NP_001286493.1 Gene:Cdk4 / 36854 FlyBaseID:FBgn0016131 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_650984.1 Gene:CG6800 / 42562 FlyBaseID:FBgn0038902 Length:302 Species:Drosophila melanogaster


Alignment Length:249 Identity:91/249 - (36%)
Similarity:136/249 - (54%) Gaps:19/249 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 DGDPFNYQELNIIGEGAYGTVYRARDVITGNIVALKKVRISLNENGVPMSTLREISLLKQLNASN 84
            |..|..|:.|..||||.:|.|::|.|:.....||:|||.:......:.::|||||..|:...:..
  Fly     3 DYAPSRYKMLEKIGEGVHGCVFKAIDLQRNKEVAIKKVALKNKFGNIALNTLREIKTLQLCKSEY 67

  Fly    85 HANIVKLYEVCQFLERDGQLLILLVFEHVEQDLSDLIDRLPKSGMSP---PTIQRLSRELLTGVD 146
            ..:|:.:|.     :..|..|:|      |.....|.:|| ||.::|   ..:::.:.::..|:.
  Fly    68 ILDIIDIYP-----DLTGLSLVL------EYQPDTLYNRL-KSEVNPLSRQQVRKFAHQMFKGIA 120

  Fly   147 FLHSHRIIHRDLKPQNLLVSSQGHLKIADFGLAKTY--GSEMKLTS-VVVTLWYRAPEVLL-AQP 207
            :||...::|||:||.|||:|....|||||||||:.|  ..|.:|.| .|.|.||||||:|. :|.
  Fly   121 YLHEAGLMHRDIKPANLLISDTDMLKIADFGLARLYFPEDESRLYSPQVSTRWYRAPEILFGSQK 185

  Fly   208 YNSTVDIWSAACIIFEMFNRRALFPGTSEKNQLDRIFELTGRPTEQQWPQTISV 261
            |.:.||:|:|.|::.||.....||.||::..||..|....|.|...|||:..|:
  Fly   186 YGTGVDMWAAGCVVAEMLRGVPLFAGTTDIEQLAIIIRTLGSPRLNQWPELTSL 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cdk4NP_001286493.1 STKc_CDK4_6_like 26..312 CDD:270831 89/243 (37%)
S_TKc 26..312 CDD:214567 89/243 (37%)
CG6800NP_650984.1 STKc_CCRK 8..295 CDD:270826 89/244 (36%)
S_TKc 9..288 CDD:214567 89/243 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442454
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24056
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.