DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cdk4 and cdk2

DIOPT Version :9

Sequence 1:NP_001286493.1 Gene:Cdk4 / 36854 FlyBaseID:FBgn0016131 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_998571.1 Gene:cdk2 / 406715 ZFINID:ZDB-GENE-040426-2741 Length:298 Species:Danio rerio


Alignment Length:298 Identity:142/298 - (47%)
Similarity:186/298 - (62%) Gaps:22/298 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 NYQELNIIGEGAYGTVYRARDVITGNIVALKKVRISLNENGVPMSTLREISLLKQLNASNHANIV 89
            ::|::..||||.||.||:|::.:||..|||||:|:.....|||.:.:|||||||:|   ||.|||
Zfish     3 SFQKVEKIGEGTYGVVYKAKNKVTGETVALKKIRLDTETEGVPSTAIREISLLKEL---NHPNIV 64

  Fly    90 KLYEVCQFLERDGQLLILLVFEHVEQDLSDLIDRLPKSGMSPPTIQRLSRELLTGVDFLHSHRII 154
            ||.:|   :..:.:|  .||||.:.|||...:|....||:|.|.::....:||.|:.|.||||::
Zfish    65 KLRDV---IHTENKL--YLVFEFLHQDLKRFMDSTSVSGISLPLVKSYLFQLLQGLAFCHSHRVL 124

  Fly   155 HRDLKPQNLLVSSQGHLKIADFGLAKTYGSEMK-LTSVVVTLWYRAPEVLLAQPYNST-VDIWSA 217
            ||||||||||:::||.:|:||||||:.:|..:: .|..||||||||||:||...|.|| |||||.
Zfish   125 HRDLKPQNLLINAQGEIKLADFGLARAFGVPVRTYTHEVVTLWYRAPEILLGCKYYSTAVDIWSL 189

  Fly   218 ACIIFEMFNRRALFPGTSEKNQLDRIFELTGRPTEQQWPQTISVALEHFPQRHPKRPK------- 275
            .||..||..|||||||.||.:||.|||...|.|.|..||...|:     |...|..||       
Zfish   190 GCIFAEMITRRALFPGDSEIDQLFRIFRTLGTPDESIWPGVTSM-----PDYKPSFPKWARQDLS 249

  Fly   276 DFCPHLCKYADDLLNKMLSYDLHLRPSALACLEHDYFQ 313
            ...|.|.:...|||.:||:||.:.|.||...|.|.:|:
Zfish   250 KVVPPLDEDGRDLLGQMLTYDPNKRISAKNALVHRFFR 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cdk4NP_001286493.1 STKc_CDK4_6_like 26..312 CDD:270831 141/294 (48%)
S_TKc 26..312 CDD:214567 141/294 (48%)
cdk2NP_998571.1 PLN00009 1..291 CDD:177649 142/298 (48%)
STKc_CDK2_3 3..286 CDD:270844 141/295 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0594
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.