DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cdk4 and Pitslre

DIOPT Version :9

Sequence 1:NP_001286493.1 Gene:Cdk4 / 36854 FlyBaseID:FBgn0016131 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_649251.2 Gene:Pitslre / 40292 FlyBaseID:FBgn0016696 Length:952 Species:Drosophila melanogaster


Alignment Length:317 Identity:125/317 - (39%)
Similarity:178/317 - (56%) Gaps:43/317 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 YQELNIIGEGAYGTVYRARDVITGNIVALKKVRISLNENGVPMSTLREI-SLLKQLNASNHANIV 89
            :|.||.|.||.||.||||:|..|..|||||::::...:.|.|:::|||| :|||    ..|.|||
  Fly   558 FQCLNRIEEGTYGVVYRAKDKRTNEIVALKRLKMEKEKEGFPITSLREINTLLK----GQHPNIV 618

  Fly    90 KLYEVCQFLERDGQLLILLVFEHVEQDLSDLIDRLP--KSGMSPPTIQRLSRELLTGVDFLHSHR 152
            .:.|:......|   .|.:|.::||.||..|::.:.  |....|..::.|:::||..|..||.:.
  Fly   619 TVREIVVGSNMD---KIFIVMDYVEHDLKSLMETMKNRKQSFFPGEVKCLTQQLLRAVAHLHDNW 680

  Fly   153 IIHRDLKPQNLLVSSQGHLKIADFGLAKTYGSEM-KLTSVVVTLWYRAPEVLLAQP-YNSTVDIW 215
            |:|||||..|||:|.:|.||:.|||||:.|||.: |.||:||||||||||:||..| |::.:|:|
  Fly   681 ILHRDLKTSNLLLSHKGILKVGDFGLAREYGSPIKKYTSLVVTLWYRAPELLLCSPVYSTPIDVW 745

  Fly   216 SAACIIFEMFNRRALFPGTSEKNQLDRIFELTGRPTEQQWP--------------------QTIS 260
            |..||..|......||||.||.::|:|||:..|.|.|:.||                    ..:|
  Fly   746 SVGCIFAEFLQMLPLFPGKSEIDELNRIFKELGTPNEKIWPGYTELPAVKNMLSQNSQFTEYPVS 810

  Fly   261 VALEHFPQRHPKRPKDFCPHLCKYADDLLNKMLSYDLHLRPSALACLEHDYFQQEPL 317
            ...:||.::           ..:....||..:|:||...|.||.|.|:|.:|::.||
  Fly   811 QLRKHFQEK-----------TSEMGLSLLQGLLTYDPKQRLSADAALKHGFFKELPL 856

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cdk4NP_001286493.1 STKc_CDK4_6_like 26..312 CDD:270831 122/310 (39%)
S_TKc 26..312 CDD:214567 122/310 (39%)
PitslreNP_649251.2 STKc_CDC2L1 552..851 CDD:173741 122/310 (39%)
PLN00009 555..854 CDD:177649 123/313 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442400
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24056
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.