DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cdk4 and CG7028

DIOPT Version :9

Sequence 1:NP_001286493.1 Gene:Cdk4 / 36854 FlyBaseID:FBgn0016131 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_001286884.1 Gene:CG7028 / 38032 FlyBaseID:FBgn0027587 Length:912 Species:Drosophila melanogaster


Alignment Length:323 Identity:88/323 - (27%)
Similarity:151/323 - (46%) Gaps:50/323 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 GEGAYGTVYRARDVITGNI-VALKKVRISLNENGVPMSTLREISLLKQLN---ASNHANIVKLYE 93
            |:|.:..|.|.||...|.. ||:|.:|   |...:..:.|||:.:||:||   ..:..:.::||.
  Fly   599 GQGVFSNVVRGRDQARGQANVAIKIIR---NNEIMHKTGLRELEILKKLNDADPEDRFHCLRLYR 660

  Fly    94 VCQFLERDGQLLILLVFEHVEQDLSDLIDRLPKS-GMSPPTIQRLSRELLTGVDFLHSHRIIHRD 157
              .|..:..   :.:|||.:..:|.:::.:..|: |:....::..:::|...:..|....|:|.|
  Fly   661 --HFFHKQH---LCMVFEPLAMNLREVLKKYGKNVGLHIKAVRSYTQQLFLALKLLKKTGILHAD 720

  Fly   158 LKPQNLLVSSQG-HLKIADFGLAKTYGSEMKLTSVVVTLWYRAPEVLLAQPYNSTVDIWSAACII 221
            :||.|:||:... .||:.|||.|... |:.::|..:|:.:||:||::|..||:..:|.|||.|.|
  Fly   721 IKPDNILVNENNLILKLCDFGSASAI-SDNEITPYLVSRFYRSPEIILGIPYDYGIDTWSAGCTI 784

  Fly   222 FEMFNRRALFPGTSEKNQLDRIFELTGR-PT---------EQQWPQTISVALEHFPQRHPKRPKD 276
            :|::..:.||.|.|....|....::.|: |.         ||.:.|:.:. |.|...:..:|.|.
  Fly   785 YELYTGKILFSGKSNNQMLKFFMDVKGKIPNRIIRKGQFREQHFDQSCNF-LYHEIDKLTEREKI 848

  Fly   277 FCPHLCK---------YAD---------------DLLNKMLSYDLHLRPSALACLEHDYFQQE 315
            ....:.|         .||               |||..|.:.|...|.|....|.|.:.|::
  Fly   849 VVMPVVKPSRSLQQELIADQNLPDDQHRKVTQLKDLLENMFALDPAKRISLNQALVHPFIQEK 911

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cdk4NP_001286493.1 STKc_CDK4_6_like 26..312 CDD:270831 87/318 (27%)
S_TKc 26..312 CDD:214567 87/318 (27%)
CG7028NP_001286884.1 STKc_PRP4 591..908 CDD:271037 87/318 (27%)
S_TKc 599..908 CDD:214567 87/318 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442430
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24056
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.