DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cdk4 and Cdk9

DIOPT Version :9

Sequence 1:NP_001286493.1 Gene:Cdk4 / 36854 FlyBaseID:FBgn0016131 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_477226.2 Gene:Cdk9 / 37586 FlyBaseID:FBgn0019949 Length:404 Species:Drosophila melanogaster


Alignment Length:331 Identity:117/331 - (35%)
Similarity:185/331 - (55%) Gaps:28/331 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LKRQKMSQAKKFGDGDPFN-YQELNIIGEGAYGTVYRARDVITGN--IVALKKVRISLNENGVPM 68
            :::||..:...|...|..| |:::..||:|.:|.|::||:. .||  .||:|||.:...:.|.|:
  Fly    30 MEKQKYIEDYDFPYCDESNKYEKVAKIGQGTFGEVFKAREK-KGNKKFVAMKKVLMDNEKEGFPI 93

  Fly    69 STLREISLLKQLNASNHANIVKLYEVC--QFLERDG-QLLILLVFEHVEQDLSDLIDRLPKSGMS 130
            :.||||.:|:.|   .|.|:|.|.|:|  :....:| :....|||:..|.||:.|:..: ....|
  Fly    94 TALREIRILQLL---KHENVVNLIEICRTKATATNGYRSTFYLVFDFCEHDLAGLLSNM-NVKFS 154

  Fly   131 PPTIQRLSRELLTGVDFLHSHRIIHRDLKPQNLLVSSQGHLKIADFGLAKTYG-----SEMKLTS 190
            ...|:::.::||.|:.::||::|:|||:|..|:|::..|.||:||||||:.:.     |:.:.|:
  Fly   155 LGEIKKVMQQLLNGLYYIHSNKILHRDMKAANVLITKHGILKLADFGLARAFSIPKNESKNRYTN 219

  Fly   191 VVVTLWYRAPEVLLA-QPYNSTVDIWSAACIIFEMFNRRALFPGTSEKNQLDRIFELTGRPTEQQ 254
            .|||||||.||:||. :.|...||:|.|.||:.||:.|..:..|.:|:.||..|.:|.|..|...
  Fly   220 RVVTLWYRPPELLLGDRNYGPPVDMWGAGCIMAEMWTRSPIMQGNTEQQQLTFISQLCGSFTPDV 284

  Fly   255 WPQTISVALE---HFPQRHPKRPKDFCPHLCKYAD-----DLLNKMLSYDLHLRPSALACLEHDY 311
            ||....:.|.   ..|:...:|.|:   .|..|..     |||:|:|:.|...|..|...|.||:
  Fly   285 WPGVEELELYKSIELPKNQKRRVKE---RLRPYVKDQTGCDLLDKLLTLDPKKRIDADTALNHDF 346

  Fly   312 FQQEPL 317
            |..:|:
  Fly   347 FWTDPM 352

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cdk4NP_001286493.1 STKc_CDK4_6_like 26..312 CDD:270831 110/304 (36%)
S_TKc 26..312 CDD:214567 110/304 (36%)
Cdk9NP_477226.2 STKc_CDK9 37..347 CDD:270848 113/317 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442445
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24056
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.