DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cdk4 and Cdk5

DIOPT Version :9

Sequence 1:NP_001286493.1 Gene:Cdk4 / 36854 FlyBaseID:FBgn0016131 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_477080.1 Gene:Cdk5 / 36727 FlyBaseID:FBgn0013762 Length:294 Species:Drosophila melanogaster


Alignment Length:294 Identity:130/294 - (44%)
Similarity:173/294 - (58%) Gaps:18/294 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 YQELNIIGEGAYGTVYRARDVITGNIVALKKVRISLNENGVPMSTLREISLLKQLNASNHANIVK 90
            |.::..||||.||||::.|:..|..|||||:||:..::.|||.|.||||.|||:|   .|.|||:
  Fly     4 YDKMEKIGEGTYGTVFKGRNRDTMEIVALKRVRLDEDDEGVPSSALREICLLKEL---KHKNIVR 65

  Fly    91 LYEVCQFLERDGQLLILLVFEHVEQDLSDLIDRLPKSGMSPPTIQRLSRELLTGVDFLHSHRIIH 155
            |.:|   |..|.:|  .|||||.:|||....|.| ...:.....:....:||.|:.|.|||.::|
  Fly    66 LIDV---LHSDKKL--TLVFEHCDQDLKKYFDSL-NGEIDMAVCRSFMLQLLRGLAFCHSHNVLH 124

  Fly   156 RDLKPQNLLVSSQGHLKIADFGLAKTYGSEMKLTSV-VVTLWYRAPEVLL-AQPYNSTVDIWSAA 218
            |||||||||::..|.||:||||||:.:|..:|..|. |||||||.|:||. |:.|.:::|:|||.
  Fly   125 RDLKPQNLLINKNGELKLADFGLARAFGIPVKCYSAEVVTLWYRPPDVLFGAKLYTTSIDMWSAG 189

  Fly   219 CIIFEMFNR-RALFPGTSEKNQLDRIFELTGRPTEQQWPQTIS----VALEHFPQRHPKRPKDFC 278
            ||:.|:.:. |.||||:...:||.:||.:.|.|.|..||....    |||..||.  ........
  Fly   190 CILAELADAGRPLFPGSDVLDQLMKIFRVLGTPNEDSWPGVSHLSDYVALPSFPA--ITSWSQLV 252

  Fly   279 PHLCKYADDLLNKMLSYDLHLRPSALACLEHDYF 312
            |.|.....|||.|:|....:.|.||.|.::|.||
  Fly   253 PRLNSKGRDLLQKLLICRPNQRISAEAAMQHPYF 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cdk4NP_001286493.1 STKc_CDK4_6_like 26..312 CDD:270831 128/292 (44%)
S_TKc 26..312 CDD:214567 128/292 (44%)
Cdk5NP_477080.1 PLN00009 1..288 CDD:177649 130/294 (44%)
STKc_CDK5 3..286 CDD:143344 128/292 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442456
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24056
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.