DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cdk4 and Cdk2

DIOPT Version :9

Sequence 1:NP_001286493.1 Gene:Cdk4 / 36854 FlyBaseID:FBgn0016131 Length:317 Species:Drosophila melanogaster
Sequence 2:XP_006240840.1 Gene:Cdk2 / 362817 RGDID:70486 Length:346 Species:Rattus norvegicus


Alignment Length:346 Identity:144/346 - (41%)
Similarity:188/346 - (54%) Gaps:70/346 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 NYQELNIIGEGAYGTVYRARDVITGNIVALKKVRISLNENGVPMSTLREISLLKQLNASNHANIV 89
            |:|::..||||.||.||:|::.:||.:|||||:|:.....|||.:.:|||||||:|   ||.|||
  Rat     3 NFQKVEKIGEGTYGVVYKAKNKLTGEVVALKKIRLDTETEGVPSTAIREISLLKEL---NHPNIV 64

  Fly    90 KLYEVCQFLERDGQLLILLVFEHVEQDLSDLIDRLPKSGMSPPTIQRLSRELLTGVDFLHSHRII 154
            ||.:|   :..:.:|  .||||.:.|||...:|....:|:..|.|:....:||.|:.|.||||::
  Rat    65 KLLDV---IHTENKL--YLVFEFLHQDLKKFMDASALTGIPLPLIKSYLFQLLQGLAFCHSHRVL 124

  Fly   155 HRDLKPQNLLVSSQGHLKIADFGLAKTYGSEMK-LTSVVVTLWYRAPEVLLAQPYNST-VDIWSA 217
            ||||||||||::::|.:|:||||||:.:|..:: .|..||||||||||:||...|.|| |||||.
  Rat   125 HRDLKPQNLLINAEGSIKLADFGLARAFGVPVRTYTHEVVTLWYRAPEILLGCKYYSTAVDIWSL 189

  Fly   218 ACIIFEM------------------------------------------------FNRRALFPGT 234
            .||..||                                                ..|||||||.
  Rat   190 GCIFAEMHLVCTQHHAKCCGEHRRNGRHSLCPLCSYLEVAASQGGGMTAVSTPYPVTRRALFPGD 254

  Fly   235 SEKNQLDRIFELTGRPTEQQWPQTISVALEHFPQRHPKRPK----DF---CPHLCKYADDLLNKM 292
            ||.:||.|||...|.|.|..||...|:     |...|..||    ||   .|.|.:....||::|
  Rat   255 SEIDQLFRIFRTLGTPDEVVWPGVTSM-----PDYKPSFPKWARQDFSKVVPPLDEDGRSLLSQM 314

  Fly   293 LSYDLHLRPSALACLEHDYFQ 313
            |.||.:.|.||.|.|.|.:||
  Rat   315 LHYDPNKRISAKAALAHPFFQ 335

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cdk4NP_001286493.1 STKc_CDK4_6_like 26..312 CDD:270831 141/342 (41%)
S_TKc 26..312 CDD:214567 141/342 (41%)
Cdk2XP_006240840.1 STKc_CDK2_3 3..334 CDD:270844 142/343 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0594
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.