DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cdk4 and Cdk14

DIOPT Version :9

Sequence 1:NP_001286493.1 Gene:Cdk4 / 36854 FlyBaseID:FBgn0016131 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_001382511.1 Gene:Cdk14 / 362316 RGDID:1305544 Length:469 Species:Rattus norvegicus


Alignment Length:335 Identity:130/335 - (38%)
Similarity:183/335 - (54%) Gaps:48/335 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 VRQLKRQKMSQAKKFGDGDPFNYQELNIIGEGAYGTVYRARDVITGNIVALKKVRISLNENGVPM 68
            ||:........:.|||..|  :|::|..:|||:|.|||:.:..:.|.:||||.:|:. .|.|.|.
  Rat   115 VRRHSSPSSPTSPKFGKAD--SYEKLEKLGEGSYATVYKGKSKVNGKLVALKVIRLQ-EEEGTPF 176

  Fly    69 STLREISLLKQLNASNHANIVKLYEVCQFLERDGQLLILLVFEHVEQDLSDLIDRLPKSGMSPPT 133
            :.:||.||||.|   .|||||.|:::....|     .:.||||:|..||...:|:.| .|:.|..
  Rat   177 TAIREASLLKGL---KHANIVLLHDIIHTKE-----TLTLVFEYVHTDLCQYMDKHP-GGLHPDN 232

  Fly   134 IQRLSRELLTGVDFLHSHRIIHRDLKPQNLLVSSQGHLKIADFGLAK-------TYGSEMKLTSV 191
            ::....:||.|:.::|...|:||||||||||:|..|.||:||||||:       ||.:|      
  Rat   233 VKLFLFQLLRGLSYIHQRYILHRDLKPQNLLISDTGELKLADFGLARAKSVPSHTYSNE------ 291

  Fly   192 VVTLWYRAPEVLL-AQPYNSTVDIWSAACIIFEMFNRRALFPGTSE-KNQLDRIFELTGRPTEQQ 254
            |||||||.|:||| :..|::.:|:|...||..||....|.|||..: ::||:|||.:.|.|.|..
  Rat   292 VVTLWYRPPDVLLGSTEYSTCLDMWGVGCIFVEMIQGVAAFPGMKDIQDQLERIFLVLGTPNEDT 356

  Fly   255 WPQTISVALEHFPQRHPKRPKDFCPHLCK-------------YADDLLNKMLSYDLHLRPSALAC 306
            ||...|  |.||      :|:.|..:..|             :|:||.:|:|......|.||.|.
  Rat   357 WPGVHS--LPHF------KPERFTVYSSKSLRQAWNKLSYVNHAEDLASKLLQCSPKNRLSAQAA 413

  Fly   307 LEHDYFQQEP 316
            |.|:||...|
  Rat   414 LSHEYFSDLP 423

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cdk4NP_001286493.1 STKc_CDK4_6_like 26..312 CDD:270831 121/307 (39%)
S_TKc 26..312 CDD:214567 121/307 (39%)
Cdk14NP_001382511.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.