DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cdk4 and Cdk1

DIOPT Version :9

Sequence 1:NP_001286493.1 Gene:Cdk4 / 36854 FlyBaseID:FBgn0016131 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_476797.1 Gene:Cdk1 / 34411 FlyBaseID:FBgn0004106 Length:297 Species:Drosophila melanogaster


Alignment Length:295 Identity:125/295 - (42%)
Similarity:172/295 - (58%) Gaps:17/295 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 NYQELNIIGEGAYGTVYRARDVITGNIVALKKVRISLNENGVPMSTLREISLLKQLNASNHANIV 89
            :::::..||||.||.||:.|:.:||.|||:||:|:..::.|||.:.:|||||||:|   .|.|||
  Fly     3 DFEKIEKIGEGTYGVVYKGRNRLTGQIVAMKKIRLESDDEGVPSTAIREISLLKEL---KHENIV 64

  Fly    90 KLYEVCQFLERDGQLLILLVFEHVEQDLSDLIDRLP-KSGMSPPTIQRLSRELLTGVDFLHSHRI 153
            .|.:|.....|     |.|:||.:..||...:|.|| ...|....::....::.:.:.|.|..|:
  Fly    65 CLEDVLMEENR-----IYLIFEFLSMDLKKYMDSLPVDKHMESELVRSYLYQITSAILFCHRRRV 124

  Fly   154 IHRDLKPQNLLVSSQGHLKIADFGLAKTYGSEMKL-TSVVVTLWYRAPEVLLAQP-YNSTVDIWS 216
            :||||||||||:...|.:|:|||||.:::|..::: |..:||||||||||||..| |:..|||||
  Fly   125 LHRDLKPQNLLIDKSGLIKVADFGLGRSFGIPVRIYTHEIVTLWYRAPEVLLGSPRYSCPVDIWS 189

  Fly   217 AACIIFEMFNRRALFPGTSEKNQLDRIFELTGRPTEQQWPQTISVALEHFPQRHPKRPKDFCPHL 281
            ..||..||..|:.||.|.||.:||.|:|.:...|||..||...|  |..:....|....:...:.
  Fly   190 IGCIFAEMATRKPLFQGDSEIDQLFRMFRILKTPTEDIWPGVTS--LPDYKNTFPCWSTNQLTNQ 252

  Fly   282 CKYAD----DLLNKMLSYDLHLRPSALACLEHDYF 312
            .|..|    ||:.|||.||...|.||...|||.||
  Fly   253 LKNLDANGIDLIQKMLIYDPVHRISAKDILEHPYF 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cdk4NP_001286493.1 STKc_CDK4_6_like 26..312 CDD:270831 123/292 (42%)
S_TKc 26..312 CDD:214567 123/292 (42%)
Cdk1NP_476797.1 STKc_CDK1_euk 3..287 CDD:270845 123/293 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442453
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0594
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24056
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.