DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cdk4 and CG7236

DIOPT Version :9

Sequence 1:NP_001286493.1 Gene:Cdk4 / 36854 FlyBaseID:FBgn0016131 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_608950.3 Gene:CG7236 / 33798 FlyBaseID:FBgn0031730 Length:438 Species:Drosophila melanogaster


Alignment Length:325 Identity:103/325 - (31%)
Similarity:156/325 - (48%) Gaps:43/325 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 RQLKRQKMSQAKKFGDGDPFNYQELNIIGEGAYGTVYRARDVITGNIVALKKVRISLNENGVPMS 69
            ||.:.|..|:..:        |::|:.:|||:||.||:.||..||.:||:|:...|.::..:...
  Fly    37 RQYRPQGSSKMDR--------YEKLSRLGEGSYGVVYKCRDRETGALVAVKRFVESEDDPAIRKI 93

  Fly    70 TLREISLLKQLNASNHANIVKLYEVCQFLERDGQLLILLVFEHVEQDLSDLIDRLPKSGMSPPTI 134
            .||||.|||.|   .|.|:|.|.||.:...|     :.||||..|..:...::|.|: |......
  Fly    94 ALREIRLLKNL---KHPNLVSLLEVFRRKRR-----LHLVFEFCELTVLHELERHPQ-GCPEHLT 149

  Fly   135 QRLSRELLTGVDFLHSHRIIHRDLKPQNLLVSSQGHLKIADFGLAKTYGSEMKLTSVVVTLWYRA 199
            :::..:.|.||.:.|....:|||:||:|:|:::||.:|:.|||.|:........|..|.|.||||
  Fly   150 KQICYQTLLGVAYCHKQGCLHRDIKPENILLTAQGQVKLCDFGFARMLSPGENYTDYVATRWYRA 214

  Fly   200 PEVLLAQ-PYNSTVDIWSAACIIFEMFNRRALFPGTSEKNQLDRIFELTG--RPTEQQ------- 254
            ||:|:.. .|.:.||:|:..|:..|:....||:||.|:.:||..|.:..|  .|...|       
  Fly   215 PELLVGDTQYGTPVDVWAIGCLFAELVRGEALWPGRSDVDQLYLIRKTLGDLLPRHIQIFGQNEY 279

  Fly   255 -------WPQTISVALEHFPQRHPKRPKDFCPHLCKYADDLLNKMLSYDLHLRPSALACLEHDYF 312
                   .|.|:....:..|.:..:.|...         |.|.|.|..|...|.|.....:|.||
  Fly   280 FKGITLPVPPTLEPLEDKMPAKSQQNPLTI---------DFLKKCLDKDPTKRWSCEKLTKHSYF 335

  Fly   313  312
              Fly   336  335

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cdk4NP_001286493.1 STKc_CDK4_6_like 26..312 CDD:270831 97/302 (32%)
S_TKc 26..312 CDD:214567 97/302 (32%)
CG7236NP_608950.3 STKc_CDKL1_4 48..335 CDD:270837 97/312 (31%)
Pkinase 50..335 CDD:278497 97/302 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442457
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24056
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.