DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cdk4 and E030030I06Rik

DIOPT Version :9

Sequence 1:NP_001286493.1 Gene:Cdk4 / 36854 FlyBaseID:FBgn0016131 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_001241673.1 Gene:E030030I06Rik / 319887 MGIID:2442914 Length:246 Species:Mus musculus


Alignment Length:44 Identity:11/44 - (25%)
Similarity:25/44 - (56%) Gaps:0/44 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 GNIVALKKVRISLNENGVPMSTLREISLLKQLNASNHANIVKLY 92
            |..:..|:.|:..:|..:.:||:||:::|:.|.......:|:.:
Mouse   134 GRFLIPKRQRVQTSEEDLRLSTVREVAVLRHLETLEQPYVVRAF 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cdk4NP_001286493.1 STKc_CDK4_6_like 26..312 CDD:270831 11/44 (25%)
S_TKc 26..312 CDD:214567 11/44 (25%)
E030030I06RikNP_001241673.1 PKc_like 114..>177 CDD:304357 11/42 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0594
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.