DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cdk4 and Cdk7

DIOPT Version :9

Sequence 1:NP_001286493.1 Gene:Cdk4 / 36854 FlyBaseID:FBgn0016131 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_511044.1 Gene:Cdk7 / 31441 FlyBaseID:FBgn0263237 Length:353 Species:Drosophila melanogaster


Alignment Length:309 Identity:115/309 - (37%)
Similarity:174/309 - (56%) Gaps:39/309 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 YQELNIIGEGAYGTVYRARDVITGNIVALKKVRISLNE---NGVPMSTLREISLLKQLNASNHAN 87
            |.:|:.:|||.:.|||:|||.:|..|||:||::....|   :|:..:.||||.:|::|   .|.|
  Fly    12 YAKLSFLGEGQFATVYKARDTVTNQIVAVKKIKKGSREDARDGINRTALREIKILQEL---QHEN 73

  Fly    88 IVKLYEVCQFLERDGQLL-ILLVFEHVEQDLSDLIDRLPKSGMSPPTIQRLSRELLTGVDFLHSH 151
            |:.|.:|.      |||. :.|||:.::.|| ::|.:..|..::...|:..:...|.|:::||.:
  Fly    74 IIGLVDVF------GQLSNVSLVFDFMDTDL-EVIIKDNKIILTQANIKAYAIMTLKGLEYLHLN 131

  Fly   152 RIIHRDLKPQNLLVSSQGHLKIADFGLAKTYGSEMKL-TSVVVTLWYRAPEVLL-AQPYNSTVDI 214
            .|:||||||.||||:|.|.|||.||||||::||..:: |..|||.|||:||:|. |:.|.:.||:
  Fly   132 WILHRDLKPNNLLVNSDGILKIGDFGLAKSFGSPNRIYTHHVVTRWYRSPELLFGARQYGTGVDM 196

  Fly   215 WSAACIIFEMFNRRALFPGTSEKNQLDRIFELTGRPTEQQWPQTISVALEHFPQRH--------P 271
            |:..||:.|:..|....||.|:.:||.|||...|.|||.:||        |..:.|        |
  Fly   197 WAVGCILAELMLRVPFMPGDSDLDQLTRIFSTLGTPTEAEWP--------HLSKLHDYLQFRNFP 253

  Fly   272 KRPKDFCPHLCKYADD----LLNKMLSYDLHLRPSALACLEHDYFQQEP 316
            ..|.|   ::...|.:    |:.::.:.:...|.|....|...||..:|
  Fly   254 GTPLD---NIFTAAGNDLIHLMQRLFAMNPLRRVSCREALSMPYFANKP 299

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cdk4NP_001286493.1 STKc_CDK4_6_like 26..312 CDD:270831 112/303 (37%)
S_TKc 26..312 CDD:214567 112/303 (37%)
Cdk7NP_511044.1 PTZ00024 6..308 CDD:240233 115/309 (37%)
STKc_CDK7 11..308 CDD:270833 115/309 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442388
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24056
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.