DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cdk4 and Cdk18

DIOPT Version :9

Sequence 1:NP_001286493.1 Gene:Cdk4 / 36854 FlyBaseID:FBgn0016131 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_001093976.1 Gene:Cdk18 / 289019 RGDID:1309523 Length:451 Species:Rattus norvegicus


Alignment Length:320 Identity:127/320 - (39%)
Similarity:185/320 - (57%) Gaps:30/320 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 RQLKRQKMSQAKKFGDGDPFNYQELNIIGEGAYGTVYRARDVITGNIVALKKVRISLNENGVPMS 69
            |..:|..:|.   .|.|....|.:|:.:|||.|.||::.|..:|.|:||||::|:. :|.|.|.:
  Rat   103 RMSRRASLSD---IGFGKLETYVKLDKLGEGTYATVFKGRSKLTENLVALKEIRLE-HEEGAPCT 163

  Fly    70 TLREISLLKQLNASNHANIVKLYEVCQFLERDGQLLILLVFEHVEQDLSDLIDRLPKSGMSPPTI 134
            .:||:||||.|   .|||||.|:::   :..|..|  .||||:::.||...:|..... |:...:
  Rat   164 AIREVSLLKDL---KHANIVTLHDL---IHTDRSL--TLVFEYLDSDLKQYLDHCGNL-MNMHNV 219

  Fly   135 QRLSRELLTGVDFLHSHRIIHRDLKPQNLLVSSQGHLKIADFGLA-------KTYGSEMKLTSVV 192
            :....:||.|:.:.|..:|:||||||||||::.:|.||:||||||       |||.:|      |
  Rat   220 KIFMFQLLRGLAYCHRRKILHRDLKPQNLLINERGELKLADFGLARAKSVPTKTYSNE------V 278

  Fly   193 VTLWYRAPEVLL-AQPYNSTVDIWSAACIIFEMFNRRALFPGTSEKNQLDRIFELTGRPTEQQWP 256
            ||||||.|:||| :..|::.:|:|...||::||...:.||||::.|.:|..||.|.|.|||:.||
  Rat   279 VTLWYRPPDVLLGSTEYSTPIDMWGVGCILYEMATGKPLFPGSTVKEELHLIFRLLGTPTEESWP 343

  Fly   257 QTISVA---LEHFPQRHPKRPKDFCPHLCKYADDLLNKMLSYDLHLRPSALACLEHDYFQ 313
            ...|::   ..:||:..|:......|.|.....:||..:|.|:...|.||.|.|.|.|||
  Rat   344 GVTSISEFRAYNFPRYLPQPLLSHAPRLDTEGINLLTSLLLYESKSRMSAEAALSHPYFQ 403

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cdk4NP_001286493.1 STKc_CDK4_6_like 26..312 CDD:270831 119/296 (40%)
S_TKc 26..312 CDD:214567 119/296 (40%)
Cdk18NP_001093976.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 39..61
PKc_like 115..402 CDD:419665 120/302 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.