DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cdk4 and csk1

DIOPT Version :9

Sequence 1:NP_001286493.1 Gene:Cdk4 / 36854 FlyBaseID:FBgn0016131 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_593019.1 Gene:csk1 / 2543327 PomBaseID:SPAC1D4.06c Length:306 Species:Schizosaccharomyces pombe


Alignment Length:291 Identity:73/291 - (25%)
Similarity:134/291 - (46%) Gaps:47/291 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 GTVYRARDVITGNIVALKKVRISLNENGV-----PMSTLREISLLKQLNASNHANIVKLYEVCQF 97
            ||:   .:|..|.....||:.: :...|:     |...:|...:|:.:   .|.:|.::  |..|
pombe    20 GTI---SEVFVGERKNSKKLYV-IKVQGLVFKRPPHDAMRGKLILESI---GHPHIERI--VDSF 75

  Fly    98 LERD-GQLLILLVFEHVEQDLSDLIDRLPKSGMSPPTIQRLSRELLTGVDFLHSHRIIHRDLKPQ 161
            ::.: |.:.::..|:...  |||::|.:     |..|..::..::.:.:::|..|.|:|||:.|.
pombe    76 IDNEAGSVYLITSFKSFV--LSDVMDEI-----SIDTKCKIVLQISSALEYLEKHGILHRDIHPN 133

  Fly   162 NLLVSS-QGHLKIADFGLA--KTYGSE--MKLTSVVVTLWYRAPEVLL-AQPYNSTVDIWSAACI 220
            |:|:.| .|...::||.:|  |.:..|  .:|...:.|..|||.|.|. ...|...||.|:...:
pombe   134 NILLDSMNGPAYLSDFSIAWSKQHPGEEVQELIPQIGTGHYRAIETLFGCHSYGHEVDRWTFGIL 198

  Fly   221 IFEMFNRRALF-PGTSE--KNQL---DRIFELTGRPTEQQWPQTISVALEHFP-------QRHPK 272
            |.|:|:.:||| .|:||  .::|   ..|.:..|.|....||:     |..||       ..:|.
pombe   199 IAELFSNQALFDDGSSEGWPSELRLTSSIIQTLGTPNPSMWPE-----LSTFPDWNKFIFHEYPP 258

  Fly   273 RP-KDFCPHLCKYADDLLNKMLSYDLHLRPS 302
            :| .:..|.:......:::.:::|.....||
pombe   259 KPWSEILPSVDTSIQYIVSHLVTYSNRASPS 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cdk4NP_001286493.1 STKc_CDK4_6_like 26..312 CDD:270831 73/291 (25%)
S_TKc 26..312 CDD:214567 73/291 (25%)
csk1NP_593019.1 S_TKc 12..247 CDD:214567 66/247 (27%)
PKc_like 14..269 CDD:304357 70/269 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0594
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.