DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cdk4 and Cdk16

DIOPT Version :9

Sequence 1:NP_001286493.1 Gene:Cdk4 / 36854 FlyBaseID:FBgn0016131 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_035179.1 Gene:Cdk16 / 18555 MGIID:97516 Length:496 Species:Mus musculus


Alignment Length:319 Identity:119/319 - (37%)
Similarity:186/319 - (58%) Gaps:30/319 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 RQLKRQKMSQAKKFGDGDPFNYQELNIIGEGAYGTVYRARDVITGNIVALKKVRISLNENGVPMS 69
            |:|:|..:|:   .|.|....|.:|:.:|||.|.|||:.:..:|.|:||||::|:. :|.|.|.:
Mouse   147 RRLRRVSLSE---IGFGKLETYIKLDKLGEGTYATVYKGKSKLTDNLVALKEIRLE-HEEGAPCT 207

  Fly    70 TLREISLLKQLNASNHANIVKLYEVCQFLERDGQLLILLVFEHVEQDLSDLIDRLPKSGMSPPTI 134
            .:||:||||.|   .|||||.|:::.. .|:.    :.||||::::||...:|.. .:.::...:
Mouse   208 AIREVSLLKDL---KHANIVTLHDIIH-TEKS----LTLVFEYLDKDLKQYLDDC-GNVINMHNV 263

  Fly   135 QRLSRELLTGVDFLHSHRIIHRDLKPQNLLVSSQGHLKIADFGLA-------KTYGSEMKLTSVV 192
            :....:||.|:.:.|..:::||||||||||::.:|.||:||||||       |||.:|      |
Mouse   264 KLFLFQLLRGLAYCHRQKVLHRDLKPQNLLINERGELKLADFGLARAKSIPTKTYSNE------V 322

  Fly   193 VTLWYRAPEVLL-AQPYNSTVDIWSAACIIFEMFNRRALFPGTSEKNQLDRIFELTGRPTEQQWP 256
            ||||||.|::|| :..|::.:|:|...||.:||...|.||||::.:.||..||.:.|.|||:.||
Mouse   323 VTLWYRPPDILLGSTDYSTQIDMWGVGCIFYEMATGRPLFPGSTVEEQLHFIFRILGTPTEETWP 387

  Fly   257 QTIS---VALEHFPQRHPKRPKDFCPHLCKYADDLLNKMLSYDLHLRPSALACLEHDYF 312
            ..:|   ....::|:...:......|.|.....|||.|:|.::...|.||....:|.:|
Mouse   388 GILSNEEFRTYNYPKYRAEALLSHAPRLDSDGADLLTKLLQFEGRNRISAEDARKHPFF 446

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cdk4NP_001286493.1 STKc_CDK4_6_like 26..312 CDD:270831 112/296 (38%)
S_TKc 26..312 CDD:214567 112/296 (38%)
Cdk16NP_035179.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..95
STKc_PCTAIRE1 162..458 CDD:270854 113/301 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0594
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.