DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cdk4 and cdk-4

DIOPT Version :9

Sequence 1:NP_001286493.1 Gene:Cdk4 / 36854 FlyBaseID:FBgn0016131 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_510256.1 Gene:cdk-4 / 181472 WormBaseID:WBGene00000406 Length:342 Species:Caenorhabditis elegans


Alignment Length:312 Identity:122/312 - (39%)
Similarity:179/312 - (57%) Gaps:6/312 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LKRQKMSQAKKFGD-GDPFNYQELNI---IGEGAYGTVYRARDVITGNIVALKKVRISLNENGVP 67
            |:.|||......|. ..|...::..|   :|:||||.|||.|.:..|...|||::.||....|:|
 Worm    15 LRLQKMMNNMTCGQMAKPLTMKDFQIHQALGKGAYGNVYRVRSLHDGKDYALKQIMISSKNEGIP 79

  Fly    68 MSTLREISLLKQLNASNHANIVKLYEVCQFLERDGQLL-ILLVFEHVEQDLSDLIDRLPKSGMSP 131
            .|.||||:::|.|....|.||:.|..|...|:....:| |.::.|..:.||...:..:|: |:..
 Worm    80 QSVLREITVMKHLARKAHPNIISLKSVFHQLDPVRAILKINMIMERCDWDLHTFLRNIPR-GVPE 143

  Fly   132 PTIQRLSRELLTGVDFLHSHRIIHRDLKPQNLLVSSQGHLKIADFGLAKTYGSEMKLTSVVVTLW 196
            ...:.::.:::..:||||:|.||||||||||:|::....:|:|||||:|.|.:....|::|||||
 Worm   144 QQAKHVTAQIVRALDFLHTHSIIHRDLKPQNILLNRDQTVKLADFGLSKEYSNTTAFTTLVVTLW 208

  Fly   197 YRAPEVLLAQPYNSTVDIWSAACIIFEMFNRRALFPGTSEKNQLDRIFELTGRPTEQQWPQTISV 261
            ||:|||||...||||||:|:..||:.|::.|:.||.|.:|..||..||:..|.|..:.||....:
 Worm   209 YRSPEVLLQSYYNSTVDMWALGCIVSEIYCRQPLFVGQNEAEQLTDIFKKMGTPVGKDWPSESVI 273

  Fly   262 ALEHFPQRHPKRPKDFCPHLCKYADDLLNKMLSYDLHLRPSALACLEHDYFQ 313
            |.:.|||..|...||..|.:.|.|.:.:.:.|.||...|.||...|.|.:.:
 Worm   274 ARDSFPQYRPTNLKDLSPQMSKQAIEFVQQCLRYDHSKRLSARGALSHPFLK 325

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cdk4NP_001286493.1 STKc_CDK4_6_like 26..312 CDD:270831 116/289 (40%)
S_TKc 26..312 CDD:214567 116/289 (40%)
cdk-4NP_510256.1 PKc_like 38..324 CDD:304357 116/286 (41%)
S_TKc 38..324 CDD:214567 116/286 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160156300
Domainoid 1 1.000 223 1.000 Domainoid score I1463
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H963
Inparanoid 1 1.050 224 1.000 Inparanoid score I2250
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53505
OrthoDB 1 1.010 - - D419040at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_108285
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2222
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
109.810

Return to query results.
Submit another query.