DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cdk4 and CDK6

DIOPT Version :9

Sequence 1:NP_001286493.1 Gene:Cdk4 / 36854 FlyBaseID:FBgn0016131 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_001138778.1 Gene:CDK6 / 1021 HGNCID:1777 Length:326 Species:Homo sapiens


Alignment Length:289 Identity:135/289 - (46%)
Similarity:198/289 - (68%) Gaps:1/289 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 YQELNIIGEGAYGTVYRARDVIT-GNIVALKKVRISLNENGVPMSTLREISLLKQLNASNHANIV 89
            |:.:..|||||||.|::|||:.. |..||||:||:...|.|:|:||:||:::|:.|....|.|:|
Human    13 YECVAEIGEGAYGKVFKARDLKNGGRFVALKRVRVQTGEEGMPLSTIREVAVLRHLETFEHPNVV 77

  Fly    90 KLYEVCQFLERDGQLLILLVFEHVEQDLSDLIDRLPKSGMSPPTIQRLSRELLTGVDFLHSHRII 154
            :|::||.....|.:..:.||||||:|||:..:|::|:.|:...||:.:..:||.|:|||||||::
Human    78 RLFDVCTVSRTDRETKLTLVFEHVDQDLTTYLDKVPEPGVPTETIKDMMFQLLRGLDFLHSHRVV 142

  Fly   155 HRDLKPQNLLVSSQGHLKIADFGLAKTYGSEMKLTSVVVTLWYRAPEVLLAQPYNSTVDIWSAAC 219
            ||||||||:||:|.|.:|:||||||:.|..:|.|||||||||||||||||...|.:.||:||..|
Human   143 HRDLKPQNILVTSSGQIKLADFGLARIYSFQMALTSVVVTLWYRAPEVLLQSSYATPVDLWSVGC 207

  Fly   220 IIFEMFNRRALFPGTSEKNQLDRIFELTGRPTEQQWPQTISVALEHFPQRHPKRPKDFCPHLCKY 284
            |..|||.|:.||.|:|:.:||.:|.::.|.|.|:.||:.:::..:.|..:..:..:.|...:.:.
Human   208 IFAEMFRRKPLFRGSSDVDQLGKILDVIGLPGEEDWPRDVALPRQAFHSKSAQPIEKFVTDIDEL 272

  Fly   285 ADDLLNKMLSYDLHLRPSALACLEHDYFQ 313
            ..|||.|.|:::...|.||.:.|.|.|||
Human   273 GKDLLLKCLTFNPAKRISAYSALSHPYFQ 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cdk4NP_001286493.1 STKc_CDK4_6_like 26..312 CDD:270831 132/286 (46%)
S_TKc 26..312 CDD:214567 132/286 (46%)
CDK6NP_001138778.1 STKc_CDK6 11..300 CDD:270846 132/286 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 278 1.000 Domainoid score I1720
eggNOG 1 0.900 - - E1_KOG0594
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H963
Inparanoid 1 1.050 280 1.000 Inparanoid score I2907
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D419040at33208
OrthoFinder 1 1.000 - - FOG0004605
OrthoInspector 1 1.000 - - otm41504
orthoMCL 1 0.900 - - OOG6_108285
Panther 1 1.100 - - LDO PTHR24056
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2222
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1312.830

Return to query results.
Submit another query.