DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cdk4 and cdk16

DIOPT Version :9

Sequence 1:NP_001286493.1 Gene:Cdk4 / 36854 FlyBaseID:FBgn0016131 Length:317 Species:Drosophila melanogaster
Sequence 2:XP_031762670.1 Gene:cdk16 / 100037876 XenbaseID:XB-GENE-5856779 Length:522 Species:Xenopus tropicalis


Alignment Length:321 Identity:122/321 - (38%)
Similarity:187/321 - (58%) Gaps:30/321 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 RQLKRQKMSQAKKFGDGDPFNYQELNIIGEGAYGTVYRARDVITGNIVALKKVRISLNENGVPMS 69
            |:|:|..:|:   .|.|....|.:|:.:|||.|.|||:.|..:|.|:||||::|:. :|.|.|.:
 Frog   174 RRLRRVSLSE---IGFGKLETYIKLDKLGEGTYATVYKGRSKLTENLVALKEIRLE-HEEGAPCT 234

  Fly    70 TLREISLLKQLNASNHANIVKLYEVCQFLERDGQLLILLVFEHVEQDLSDLIDRLPKSGMSPPTI 134
            .:||:||||.|   .|||||.|:::.. .||    .:.||||::::||...:|..... ::...:
 Frog   235 AIREVSLLKDL---KHANIVTLHDIIH-TER----TLTLVFEYLDKDLKQYLDDCGNL-INLHNV 290

  Fly   135 QRLSRELLTGVDFLHSHRIIHRDLKPQNLLVSSQGHLKIADFGLA-------KTYGSEMKLTSVV 192
            :....:||.|:.:.|..:::||||||||||::.:|.||:||||||       |||.:|      |
 Frog   291 KLFLYQLLRGLSYCHRRKVLHRDLKPQNLLINEKGELKLADFGLARAKSIPTKTYSNE------V 349

  Fly   193 VTLWYRAPEVLL-AQPYNSTVDIWSAACIIFEMFNRRALFPGTSEKNQLDRIFELTGRPTEQQWP 256
            ||||||.|::|| :..|::.:|:|...||.:||...|.||||::.:.||..||.:.|.|||:.||
 Frog   350 VTLWYRPPDILLGSTEYSTQIDMWGVGCIFYEMVTGRPLFPGSTVEEQLHFIFRILGTPTEETWP 414

  Fly   257 QTIS---VALEHFPQRHPKRPKDFCPHLCKYADDLLNKMLSYDLHLRPSALACLEHDYFQQ 314
            ..:|   ....::|:.:|...:.....|.....:||.|:|..:...|.||...:.|.|||:
 Frog   415 GILSNEEFKSYNYPRYYPDPIQKHAARLDSDGANLLTKLLQLEGRNRISAEEAMRHLYFQE 475

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cdk4NP_001286493.1 STKc_CDK4_6_like 26..312 CDD:270831 113/296 (38%)
S_TKc 26..312 CDD:214567 113/296 (38%)
cdk16XP_031762670.1 PKc_like 189..485 CDD:419665 116/303 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.