DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4927 and gzma

DIOPT Version :9

Sequence 1:NP_001033953.1 Gene:CG4927 / 36852 FlyBaseID:FBgn0034139 Length:362 Species:Drosophila melanogaster
Sequence 2:XP_001335166.1 Gene:gzma / 795070 ZFINID:ZDB-GENE-091204-156 Length:257 Species:Danio rerio


Alignment Length:265 Identity:72/265 - (27%)
Similarity:111/265 - (41%) Gaps:54/265 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   105 IVGGAKAAGREFPFMALLGQRGKNSSQIDWDCGAIIIHPKFVLTAAHCLETSETKEQRLDPNYDG 169
            |||| |...:...:|..: |..:|..     ||.|:||.::|||||||.|.|.:           
Zfish    28 IVGG-KDVKKALSWMVSI-QVNQNHK-----CGGILIHKEWVLTAAHCKEDSYS----------- 74

  Fly   170 PKYVVRLGELDYNSTTDDAQPQDFRVLNYVVHPAYGEDDDTGSRKNDIAVVELEMEATFSEYVAP 234
             ...|.:|.|..:..:     |...:.||.:...:.:.    ::|:||.::.|..:.....|..|
Zfish    75 -SVTVLIGSLSLSKGS-----QRIAIHNYEIPETFNKK----TKKDDIMLIRLSKKVKAKPYKIP 129

  Fly   235 ACLPLDGGNEQ-----LQVAAAGWGATSESG-HASSHLLKVSLDRYDVAECSQRL-EHKIDVRTQ 292
            .       .|:     .:....|||.|...| .||..|..:.:...|..:|::.. .:.:..:..
Zfish   130 K-------KEKDVQPGTKCVVRGWGTTDYKGKQASDKLQMLEVLVVDRVQCNRYYNRNPVITKDM 187

  Fly   293 LCAGSRSTSADTCYGDSGGPVFVQHPIYSCLKQVIGITSYGLVCGVQGLPSVYT---KVHLYTDW 354
            ||||:......||.||||||:       .|.|.::|:.|....||....|:|||   |.|:  .|
Zfish   188 LCAGNTQQHRGTCLGDSGGPL-------ECEKNLVGVLSGSHGCGDPKKPTVYTLLSKRHI--TW 243

  Fly   355 IENIV 359
            |..|:
Zfish   244 INKIL 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4927NP_001033953.1 Tryp_SPc 105..358 CDD:238113 71/262 (27%)
Tryp_SPc 105..355 CDD:214473 69/259 (27%)
gzmaXP_001335166.1 Tryp_SPc 28..247 CDD:238113 71/262 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1144875at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.