DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4927 and mettl7a

DIOPT Version :9

Sequence 1:NP_001033953.1 Gene:CG4927 / 36852 FlyBaseID:FBgn0034139 Length:362 Species:Drosophila melanogaster
Sequence 2:NP_001072195.1 Gene:mettl7a / 779641 XenbaseID:XB-GENE-5802614 Length:245 Species:Xenopus tropicalis


Alignment Length:69 Identity:17/69 - (24%)
Similarity:26/69 - (37%) Gaps:18/69 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 HIVC-------CLLPNNMQPQSQQFSANIGLRRF---EKECRRFNEIR---TSCRT-----TPFI 105
            |:.|       |.....:.|..:.......||:|   :.|..:|:.::   ...||     ||.|
 Frog   175 HVACSDEATWLCFFQRILNPTWKLVFDGCNLRKFTWKDLENAKFSTLKLRHIQARTMIKPVTPHI 239

  Fly   106 VGGA 109
            ||.|
 Frog   240 VGYA 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4927NP_001033953.1 Tryp_SPc 105..358 CDD:238113 4/5 (80%)
Tryp_SPc 105..355 CDD:214473 4/5 (80%)
mettl7aNP_001072195.1 Methyltransf_11 75..172 CDD:311935
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.