powered by:
Protein Alignment CG4927 and mettl7a
DIOPT Version :9
Sequence 1: | NP_001033953.1 |
Gene: | CG4927 / 36852 |
FlyBaseID: | FBgn0034139 |
Length: | 362 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001072195.1 |
Gene: | mettl7a / 779641 |
XenbaseID: | XB-GENE-5802614 |
Length: | 245 |
Species: | Xenopus tropicalis |
Alignment Length: | 69 |
Identity: | 17/69 - (24%) |
Similarity: | 26/69 - (37%) |
Gaps: | 18/69 - (26%) |
- Green bases have known domain annotations that are detailed below.
Fly 59 HIVC-------CLLPNNMQPQSQQFSANIGLRRF---EKECRRFNEIR---TSCRT-----TPFI 105
|:.| |.....:.|..:.......||:| :.|..:|:.:: ...|| ||.|
Frog 175 HVACSDEATWLCFFQRILNPTWKLVFDGCNLRKFTWKDLENAKFSTLKLRHIQARTMIKPVTPHI 239
Fly 106 VGGA 109
||.|
Frog 240 VGYA 243
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.910 |
|
Return to query results.
Submit another query.