DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4927 and CELA2A

DIOPT Version :9

Sequence 1:NP_001033953.1 Gene:CG4927 / 36852 FlyBaseID:FBgn0034139 Length:362 Species:Drosophila melanogaster
Sequence 2:NP_254275.1 Gene:CELA2A / 63036 HGNCID:24609 Length:269 Species:Homo sapiens


Alignment Length:269 Identity:83/269 - (30%)
Similarity:118/269 - (43%) Gaps:45/269 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   105 IVGGAKAAGREFPFMALLGQRGKNSSQIDW--DCGAIIIHPKFVLTAAHCLETSETKEQRLDPNY 167
            :|||.:|....:|:...|    :.||...|  .||..:|...:|||||||:.:|.|         
Human    29 VVGGEEARPNSWPWQVSL----QYSSNGKWYHTCGGSLIANSWVLTAAHCISSSRT--------- 80

  Fly   168 DGPKYVVRLGELDYNSTTDDAQPQDFRVLNYVVHPAYGEDDDTGSRKNDIAVVELEMEATFSEYV 232
                |.|.||.  :|....::......|...|||..:..:..  |:.||||:::|....:.::.:
Human    81 ----YRVGLGR--HNLYVAESGSLAVSVSKIVVHKDWNSNQI--SKGNDIALLKLANPVSLTDKI 137

  Fly   233 APACLPLDG----GNEQLQVAAAGWGATSESGHASSHLLKVSLDRYDVAECSQRLEHKIDVRT-Q 292
            ..||||..|    .|....|  .|||....:|.....|.:..|...|.|.||........|:| .
Human   138 QLACLPPAGTILPNNYPCYV--TGWGRLQTNGAVPDVLQQGRLLVVDYATCSSSAWWGSSVKTSM 200

  Fly   293 LCAGSRSTSADTCYGDSGGPVFVQHPIYSCLK-----QVIGITSYG--LVCGVQGLPSVYTKVHL 350
            :|||.... ..:|.||||||:       :|..     ||.||.|:|  |.|.....|||:|:|..
Human   201 ICAGGDGV-ISSCNGDSGGPL-------NCQASDGRWQVHGIVSFGSRLGCNYYHKPSVFTRVSN 257

  Fly   351 YTDWIENIV 359
            |.|||.:::
Human   258 YIDWINSVI 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4927NP_001033953.1 Tryp_SPc 105..358 CDD:238113 83/266 (31%)
Tryp_SPc 105..355 CDD:214473 81/263 (31%)
CELA2ANP_254275.1 Tryp_SPc 29..265 CDD:238113 83/266 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.