DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4927 and CG34436

DIOPT Version :9

Sequence 1:NP_001033953.1 Gene:CG4927 / 36852 FlyBaseID:FBgn0034139 Length:362 Species:Drosophila melanogaster
Sequence 2:NP_001097954.1 Gene:CG34436 / 5740743 FlyBaseID:FBgn0085465 Length:270 Species:Drosophila melanogaster


Alignment Length:266 Identity:64/266 - (24%)
Similarity:109/266 - (40%) Gaps:75/266 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   117 PFMALLGQRGKNSSQIDWDCGAIIIHPKFVLTAAHCLETSETKEQRLDPNYDGPKYVVRLGEL-- 179
            |:|||:....|.       |...:||..||:|:|.|:...|             :.:||||:|  
  Fly    42 PWMALVLLPNKT-------CSGALIHKYFVITSASCVFNQE-------------RAIVRLGQLSI 86

  Fly   180 ------DYNSTTDDAQPQDFRVLNYVVHPAYGEDDDTGSRKNDIAVVELEMEATFSEYVAPACLP 238
                  .|:|       .|:.|.:..:|..|    :..:.::|||::||:.:..:..::.|.||.
  Fly    87 KQEHIVSYSS-------DDYHVQSAYIHRFY----EKSNFEHDIALLELQNDVLYKAHIRPICLW 140

  Fly   239 LDGGNEQLQV----AAAGWG----------ATSESGHASSHLLKVSLDRYDVAECSQRLEHKIDV 289
            ||..:...|:    ....||          .||:..|.|.            .:|....: ....
  Fly   141 LDKSDIDTQMFKRYETFRWGIDEKYILPAAKTSKIKHISQ------------VKCENAFK-LYPQ 192

  Fly   290 RTQLCAGSRSTSADTCYGDSGGPVFVQHPIYSCLKQVI-GITSYGLVCGVQGLPSVYTKVHLYTD 353
            .:.:|||.::.|  .|. ::|.|:|.:...|:.::..: ||.|||     :....:||.|..|.|
  Fly   193 NSHICAGYKNKS--KCV-ETGSPLFKKIRYYTKIRYTLFGIQSYG-----ESRTCLYTDVTKYID 249

  Fly   354 WIENIV 359
            ||..::
  Fly   250 WIMGVI 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4927NP_001033953.1 Tryp_SPc 105..358 CDD:238113 64/263 (24%)
Tryp_SPc 105..355 CDD:214473 62/260 (24%)
CG34436NP_001097954.1 Tryp_SPc 40..252 CDD:304450 63/261 (24%)
Tryp_SPc 40..251 CDD:214473 62/260 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455922
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24258
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.