DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4927 and si:dkey-21e2.15

DIOPT Version :9

Sequence 1:NP_001033953.1 Gene:CG4927 / 36852 FlyBaseID:FBgn0034139 Length:362 Species:Drosophila melanogaster
Sequence 2:XP_003201076.1 Gene:si:dkey-21e2.15 / 567711 ZFINID:ZDB-GENE-050208-780 Length:251 Species:Danio rerio


Alignment Length:303 Identity:83/303 - (27%)
Similarity:121/303 - (39%) Gaps:64/303 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 IVCCLLPNNMQPQSQQFSANIGLRRFEKECRRFNEIRTSCRTTPFIVGGAKAAGREFPFMALLGQ 124
            |:..||..::.| ...|:|.:|                       |..|.:|.....|:|..|.:
Zfish     5 IISLLLLVSLVP-DLTFTARVG-----------------------IEDGTEAKPHSRPYMVSLQK 45

  Fly   125 RGKNSSQIDWDCGAIIIHPKFVLTAAHCLETSETKEQRLDPNYDGPKYVVRLGELDYNSTTDDAQ 189
            ..|||      ||..:|..:||||||||.:..           |....||...:|..|.|.|   
Zfish    46 NSKNS------CGGSLITEEFVLTAAHCWKKG-----------DVITVVVGAHDLSENETYD--- 90

  Fly   190 PQDFRVLNYVVHPAYGEDDDTGSRKNDIAVVELEMEATFSEYVAPACLPLDGGN--EQLQVAAAG 252
              .|.|.:|:.||.:...    :.:|||.:::|..:.|.|..|....||.:|.:  |....:.||
Zfish    91 --SFEVTSYIPHPEFSWQ----NYENDIMLLKLNKKVTLSNNVGLISLPKNGEDVKEDAVCSVAG 149

  Fly   253 WGATSESGHASSHLLKVSLDRYDVAECSQRLEHKIDVRTQLCAGSRSTSADTCYGDSGGPVFVQH 317
            ||....:|.....|::.........||.:|.|.........|....   ..||.||||||:.   
Zfish   150 WGRLWLNGPRPDRLMEAETVIVSGEECKRRWESLFKPSKMFCVYGH---GGTCKGDSGGPLV--- 208

  Fly   318 PIYSCLKQVIGITSYG--LVCGVQGLPSVYTKVHLYTDWIENI 358
                |.:..:|:||:.  ..|..:.||::|||:..|..||:.|
Zfish   209 ----CGEHAVGVTSFSDRYSCNSRLLPNMYTKISAYLSWIQKI 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4927NP_001033953.1 Tryp_SPc 105..358 CDD:238113 75/256 (29%)
Tryp_SPc 105..355 CDD:214473 73/253 (29%)
si:dkey-21e2.15XP_003201076.1 Tryp_SPc 26..247 CDD:238113 75/256 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.