DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4927 and AgaP_AGAP006673

DIOPT Version :9

Sequence 1:NP_001033953.1 Gene:CG4927 / 36852 FlyBaseID:FBgn0034139 Length:362 Species:Drosophila melanogaster
Sequence 2:XP_001688952.1 Gene:AgaP_AGAP006673 / 5667010 VectorBaseID:AGAP006673 Length:307 Species:Anopheles gambiae


Alignment Length:289 Identity:84/289 - (29%)
Similarity:126/289 - (43%) Gaps:39/289 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 LRRFEKECRR----FNEIRTSCRTTPFIVGGAKAAGREFPFMALL-GQRGKNSSQIDWDCGAIII 141
            :..:::..||    ...:||..:.|..|..|..|...:||:.|:: .:.|.....:   ||..|:
Mosquito    33 IEEYDRYWRRLPAELQYLRTVEQPTRRITNGQLATAGQFPYQAVVYSEAGDGYYSL---CGGTIL 94

  Fly   142 HPKFVLTAAHCLETSETKEQRLDPNYDGPKYVVRLGELDYNSTTDDAQPQDFRVLNYVVHPAYGE 206
            ...:|||||||:...      .|....|.  :|.||..|........|...|......|||.|  
Mosquito    95 TTTYVLTAAHCVTDD------FDRAVTGG--IVFLGATDRTVFQSTQQRMSFGNAGIRVHPQY-- 149

  Fly   207 DDDTGSRKNDIAVVELEMEATFSEYVAPACLPLDGGNEQ---LQVAAAGWGATSESGHASSHLLK 268
              ::.|.:||||.|.|:..|.|:.||....||......|   .:..|:|:|.|:::..|:|::| 
Mosquito   150 --NSTSIRNDIATVRLDTAAIFNTYVKAIDLPALSDARQFGGFEGTASGFGRTADTVPAASNVL- 211

  Fly   269 VSLDRYDV---AECSQRLEHKIDVRTQLCA---GSRSTSADTCYGDSGGPVFVQHPIYSCLKQVI 327
             ...|..|   |:|:......:.....:|.   |.||    .|:||||||:.||....|.   .:
Mosquito   212 -MFVRNPVMTNAQCNAYWSTAVVQAQNVCLDPYGGRS----ACHGDSGGPLAVQDAGRSL---QV 268

  Fly   328 GITSYGLVCG-VQGLPSVYTKVHLYTDWI 355
            ||.|:....| ..|.|||:.:|..:.|:|
Mosquito   269 GIASFVSANGCTSGAPSVWVRVSYFRDFI 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4927NP_001033953.1 Tryp_SPc 105..358 CDD:238113 79/262 (30%)
Tryp_SPc 105..355 CDD:214473 78/260 (30%)
AgaP_AGAP006673XP_001688952.1 Tryp_SPc 59..297 CDD:214473 78/261 (30%)
Tryp_SPc 60..300 CDD:238113 79/262 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.