DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4927 and PRSS8

DIOPT Version :9

Sequence 1:NP_001033953.1 Gene:CG4927 / 36852 FlyBaseID:FBgn0034139 Length:362 Species:Drosophila melanogaster
Sequence 2:NP_002764.1 Gene:PRSS8 / 5652 HGNCID:9491 Length:343 Species:Homo sapiens


Alignment Length:278 Identity:79/278 - (28%)
Similarity:121/278 - (43%) Gaps:46/278 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    99 CRTTP--FIVGGAKAAGREFPFMALLGQRGKNSSQIDWDCGAIIIHPKFVLTAAHCLETSETKEQ 161
            |...|  .|.||:.|...::|:...:...|.:.      ||..::..::||:||||..:...|| 
Human    37 CGVAPQARITGGSSAVAGQWPWQVSITYEGVHV------CGGSLVSEQWVLSAAHCFPSEHHKE- 94

  Fly   162 RLDPNYDGPKYVVRLGELDYNSTTDDAQPQDFRVLNYVVHPAYGEDDDTGSRKNDIAVVELEMEA 226
                     .|.|:||....:|.::||:....:  :.:.||:|.::...|    |||:::|....
Human    95 ---------AYEVKLGAHQLDSYSEDAKVSTLK--DIIPHPSYLQEGSQG----DIALLQLSRPI 144

  Fly   227 TFSEYVAPACLPLDGGN--EQLQVAAAGWGATSESGHASS----HLLKVSLDRYDVAECSQRLEH 285
            |||.|:.|.|||....:  ..|.....|||..:.|....:    ..|:|.|...:...|...::.
Human   145 TFSRYIRPICLPAANASFPNGLHCTVTGWGHVAPSVSLLTPKPLQQLEVPLISRETCNCLYNIDA 209

  Fly   286 KID-----VRTQLCAGSRSTSADTCYGDSGGPVFVQHPIYSC----LKQVIGITSYGLVCGVQGL 341
            |.:     ....:|||......|.|.||||||:       ||    |..:.||.|:|..||.:..
Human   210 KPEEPHFVQEDMVCAGYVEGGKDACQGDSGGPL-------SCPVEGLWYLTGIVSWGDACGARNR 267

  Fly   342 PSVYTKVHLYTDWIENIV 359
            |.|||....|..||::.|
Human   268 PGVYTLASSYASWIQSKV 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4927NP_001033953.1 Tryp_SPc 105..358 CDD:238113 76/267 (28%)
Tryp_SPc 105..355 CDD:214473 74/264 (28%)
PRSS8NP_002764.1 Tryp_SPc 44..281 CDD:214473 74/265 (28%)
Tryp_SPc 45..284 CDD:238113 76/267 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.