DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4927 and MASP1

DIOPT Version :9

Sequence 1:NP_001033953.1 Gene:CG4927 / 36852 FlyBaseID:FBgn0034139 Length:362 Species:Drosophila melanogaster
Sequence 2:XP_011511291.1 Gene:MASP1 / 5648 HGNCID:6901 Length:735 Species:Homo sapiens


Alignment Length:420 Identity:107/420 - (25%)
Similarity:151/420 - (35%) Gaps:117/420 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 CDNGTGECKELSATDCPSIFFNLHLIR-----NFVKYCDKSNHIVCCLLPNNMQPQSQQFSANIG 81
            ||.|....|:....|.    |.:..::     |.:..|    .||.|..|..::.....||....
Human   336 CDTGYKVLKDNVEMDT----FQIECLKDGTWSNKIPTC----KIVDCRAPGELEHGLITFSTRNN 392

  Fly    82 LRRFEKECRRFNEIRTSC-------------------------------------------RTTP 103
            |..::      :||:.||                                           |:.|
Human   393 LTTYK------SEIKYSCQEPYYKMLNNNTGIYTCSAQGVWMNKVLGRSLPTCLPECGQPSRSLP 451

  Fly   104 F----IVGGAKAAGREFPFMALLGQRGKNSSQI---DWDCGAIIIHPKFVLTAAHCLETSETKEQ 161
            .    |:||..|....||:.||:..  :::|::   .|.....::...::|||||.|     :.|
Human   452 SLVKRIIGGRNAEPGLFPWQALIVV--EDTSRVPNDKWFGSGALLSASWILTAAHVL-----RSQ 509

  Fly   162 RLDPN---YDGPKYVVRLGELDYNSTTDDAQPQDFRVLNYVVHPAYGEDDDTGSRKNDIAVVELE 223
            |.|..   .......|.||..|....:........||   |:||    |.:..:..:|||:|:|:
Human   510 RRDTTVIPVSKEHVTVYLGLHDVRDKSGAVNSSAARV---VLHP----DFNIQNYNHDIALVQLQ 567

  Fly   224 MEATFSEYVAPACLPL---DGGNEQLQVAAAGWGATS---------ESG--HASSHLLKVSLDRY 274
            .......:|.|.|||.   :|....:....||||.::         .||  ..|..|..|.|...
Human   568 EPVPLGPHVMPVCLPRLEPEGPAPHMLGLVAGWGISNPNVTVDEIISSGTRTLSDVLQYVKLPVV 632

  Fly   275 DVAECSQRLEHKID----VRTQLCAGSRSTSADTCYGDSGGPVFVQHPIYSCLKQ---VIGITSY 332
            ..|||....|.:..    .....|||......|||.||||| .||   |:..|.|   |.|:.|:
Human   633 PHAECKTSYESRSGNYSVTENMFCAGYYEGGKDTCLGDSGG-AFV---IFDDLSQRWVVQGLVSW 693

  Fly   333 G--LVCGVQGLPSVYTKVHLYTDWIENIVW 360
            |  ..||.:.:..|||||..|.||    ||
Human   694 GGPEECGSKQVYGVYTKVSNYVDW----VW 719

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4927NP_001033953.1 Tryp_SPc 105..358 CDD:238113 84/281 (30%)
Tryp_SPc 105..355 CDD:214473 83/278 (30%)
MASP1XP_011511291.1 CUB 35..144 CDD:238001
FXa_inhibition 160..188 CDD:291342
CUB 192..301 CDD:278839
Sushi 308..369 CDD:278512 7/36 (19%)
CCP 374..439 CDD:153056 9/70 (13%)
Tryp_SPc 456..718 CDD:214473 84/283 (30%)
Tryp_SPc 457..718 CDD:238113 84/282 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.