DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4927 and CG11842

DIOPT Version :9

Sequence 1:NP_001033953.1 Gene:CG4927 / 36852 FlyBaseID:FBgn0034139 Length:362 Species:Drosophila melanogaster
Sequence 2:NP_651662.1 Gene:CG11842 / 43431 FlyBaseID:FBgn0039629 Length:319 Species:Drosophila melanogaster


Alignment Length:325 Identity:110/325 - (33%)
Similarity:161/325 - (49%) Gaps:41/325 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 LIRNFVKYCDKSNHIV---CCLLPNNMQPQSQQFS-----ANIGLRRFEKECRRFNEIRTSCRTT 102
            |:.:||.:....:..:   |.....::..::.:||     |.|..:..:| |..:         .
  Fly    16 LLVSFVAWASAQDSDIARTCTAYKRSVWEETSEFSFLIENAPIIYKTLDK-CTSY---------A 70

  Fly   103 PFIVGGAKAAGREFPFMALLGQRGKNSSQIDWDCGAIIIHPKFVLTAAHCLETSETKEQRLDPNY 167
            |.|:||..|..:|||..|.||.:.:| .:::|.||..:|..:.|||||||..:.:          
  Fly    71 PLIIGGGPAVPKEFPHAARLGHKDEN-GEVEWFCGGTLISDRHVLTAAHCHYSPQ---------- 124

  Fly   168 DGPKYVVRLGELDYNSTTDDAQPQDFRVLNYVVHPAYGEDDDTGSRKNDIAVVELEMEATFSEYV 232
             |...:.|||:|::::..|||.|:||.|.::..||.:...    :..|||:||.|....||::|.
  Fly   125 -GSVNIARLGDLEFDTNNDDADPEDFDVKDFTAHPEFSYP----AIYNDISVVRLSRPVTFNDYK 184

  Fly   233 APACLPLDGGNEQLQVAAAGWGATSESGHA-SSHLLKVSLDRYD-----VAECSQRLEHKIDVRT 291
            .|||||.|.|.......|.|||........ :..|.||.|..|.     .|:.:..|....:..|
  Fly   185 HPACLPFDDGRLGTSFIAIGWGQLEIVPRTENKKLQKVKLYNYGTRCRITADRNDELPEGYNATT 249

  Fly   292 QLCAGSRSTSADTCYGDSGGPVFVQHPIYSCLKQVIGITSYGLVCGVQGLPSVYTKVHLYTDWIE 356
            |||.|| :...|||.|||||||.:.|..|.|:..|:||||.|:.|....||::||:||.|.|||:
  Fly   250 QLCIGS-NEHKDTCNGDSGGPVLIYHMDYPCMYHVMGITSIGVACDTPDLPAMYTRVHFYLDWIK 313

  Fly   357  356
              Fly   314  313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4927NP_001033953.1 Tryp_SPc 105..358 CDD:238113 99/258 (38%)
Tryp_SPc 105..355 CDD:214473 97/255 (38%)
CG11842NP_651662.1 Tryp_SPc 73..315 CDD:238113 99/258 (38%)
Tryp_SPc 73..312 CDD:214473 97/255 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BPQ8
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 119 1.000 Inparanoid score I4773
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D105391at6960
OrthoFinder 1 1.000 - - FOG0012717
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.870

Return to query results.
Submit another query.