DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4927 and CG11841

DIOPT Version :9

Sequence 1:NP_001033953.1 Gene:CG4927 / 36852 FlyBaseID:FBgn0034139 Length:362 Species:Drosophila melanogaster
Sequence 2:NP_651661.1 Gene:CG11841 / 43430 FlyBaseID:FBgn0039628 Length:319 Species:Drosophila melanogaster


Alignment Length:309 Identity:114/309 - (36%)
Similarity:155/309 - (50%) Gaps:37/309 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 CDKSNHIVCCLLPNNMQPQSQQFSANIGLRRFEKECRRFNEIRTSCR-TTPFIVGGAKAAGREFP 117
            |.|...||              |...:.:..|..:.....|...||. :.|.||.|..|..:|||
  Fly    34 CTKFKQIV--------------FEERVAISFFFTDAPITYETVDSCHGSRPLIVDGTPAEPKEFP 84

  Fly   118 FMALLGQRGKNSSQIDWDCGAIIIHPKFVLTAAHCLETSETKEQRLDPNYDGPKYVVRLGELDYN 182
            |.|.||.| |.:::|.|.||..:|..:.|||||||..:..           |...|||||||:::
  Fly    85 FAARLGHR-KTNNEIKWFCGGTLISNRLVLTAAHCFFSEH-----------GEVNVVRLGELEFD 137

  Fly   183 STTDDAQPQDFRVLNYVVHPAYGEDDDTGSRKNDIAVVELEMEATFSEYVAPACLPLDGGNEQLQ 247
            :.||||:|:||.||....||.:    :.....|||.:|:|:.|..|:.|..|||||.|.|.:...
  Fly   138 TDTDDAEPEDFGVLALKAHPGF----ENPQLYNDIGIVQLDREVKFNRYKHPACLPFDDGEQHES 198

  Fly   248 VAAAGWGATSESGHASSHLLKVSLDRY-----DVAECSQRLEHKIDVRTQLCAGSRSTSADTCYG 307
            ..|.|||....:...|..||||.|..|     ...:.:..|.:..:.::|||.|||. :.|||.|
  Fly   199 FIAIGWGQKKFAQKESKKLLKVQLQGYKDRCVSSVDANDELPNGYEPKSQLCIGSRD-NKDTCNG 262

  Fly   308 DSGGPVFVQHPIYSCLKQVIGITSYGLVCGVQGLPSVYTKVHLYTDWIE 356
            ||||||...|...:|:..|:||||.|:.|....:||.||:||.:.:||:
  Fly   263 DSGGPVLAYHKDLACMYHVMGITSAGITCSTPDIPSAYTRVHYFLNWIK 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4927NP_001033953.1 Tryp_SPc 105..358 CDD:238113 104/257 (40%)
Tryp_SPc 105..355 CDD:214473 102/254 (40%)
CG11841NP_651661.1 Tryp_SPc 72..311 CDD:238113 103/255 (40%)
Tryp_SPc 72..310 CDD:214473 102/254 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BPQ8
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 119 1.000 Inparanoid score I4773
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D105391at6960
OrthoFinder 1 1.000 - - FOG0012717
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.870

Return to query results.
Submit another query.