DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4927 and CG14642

DIOPT Version :9

Sequence 1:NP_001033953.1 Gene:CG4927 / 36852 FlyBaseID:FBgn0034139 Length:362 Species:Drosophila melanogaster
Sequence 2:NP_001246901.1 Gene:CG14642 / 40532 FlyBaseID:FBgn0037222 Length:392 Species:Drosophila melanogaster


Alignment Length:272 Identity:93/272 - (34%)
Similarity:130/272 - (47%) Gaps:44/272 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   107 GGAKAAGREFPFMALLG---QRGKNSSQIDWDCGAIIIHPKFVLTAAHCLETSETKEQRLDPNYD 168
            |...|...|:|.||.:|   .||    |:|:.||..:|..:||||||||...           |:
  Fly   146 GRVLARPGEYPHMAAVGFESDRG----QVDYKCGGSLISERFVLTAAHCTSI-----------YE 195

  Fly   169 GPKYVVRLGELDYNSTTDDAQPQDFRVLNYVVHPAYGEDDDTGSRK---NDIAVVELEMEATFSE 230
            .|...||:|:||..|.....:.|..|:.....||.|       .:|   :|||:::||.|...:|
  Fly   196 APPKWVRIGDLDLASEKRSVEAQLLRIEQVFAHPNY-------KKKMYYDDIALLKLEKEVELTE 253

  Fly   231 YVAPACLPLDGGNEQLQVAAAGWGATSESGHASSHLLKVSLDRYDVAECSQRLEHKID-----VR 290
            ||.|..|.:..........|.|:||||.:...::.|..::|.....|||:..|....:     :.
  Fly   254 YVRPVRLWVFPELPTTIAFAMGYGATSFAKPMTNRLTNLNLTVVPNAECNAELPPLAETPSGVLE 318

  Fly   291 TQLCAGSRSTSADTCYGDSGGPVFVQ-------HPIYSCLKQVIGITSYGLVCGVQGLPSVYTKV 348
            :|:||.....:.|||.||||||:.:.       |.|:   ..:|||||||:.|. ...|||||:|
  Fly   319 SQICAQDYILNRDTCQGDSGGPLQLNLPGRRRGHRIH---YHLIGITSYGVFCR-SSYPSVYTRV 379

  Fly   349 HLYTDWIENIVW 360
            ..:.||||..||
  Fly   380 SSFLDWIELTVW 391

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4927NP_001033953.1 Tryp_SPc 105..358 CDD:238113 91/268 (34%)
Tryp_SPc 105..355 CDD:214473 88/265 (33%)
CG14642NP_001246901.1 Tryp_SPc 146..387 CDD:238113 89/266 (33%)
Tryp_SPc 146..386 CDD:214473 88/265 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45469103
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24258
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.