DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4927 and CG9372

DIOPT Version :9

Sequence 1:NP_001033953.1 Gene:CG4927 / 36852 FlyBaseID:FBgn0034139 Length:362 Species:Drosophila melanogaster
Sequence 2:NP_649132.1 Gene:CG9372 / 40137 FlyBaseID:FBgn0036891 Length:408 Species:Drosophila melanogaster


Alignment Length:345 Identity:110/345 - (31%)
Similarity:168/345 - (48%) Gaps:51/345 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 TGECKELSATDCPSIFFNLHLIRNFV-----KYC--DKSNHIVCCLLPNNMQPQSQQFSANIGLR 83
            :|.|:.:       |:..:..::|.|     :.|  :||:..:||    ..|..|.:||..:...
  Fly    94 SGRCRHI-------IYCRMPELKNDVWRLVSQLCIIEKSSIGICC----TDQSTSNRFSPQVVTS 147

  Fly    84 RFEKECRRFNE-IRTSC----RTTPFIVGGAKAAGREFPFMALLGQRGKNSSQIDWDCGAIIIHP 143
            ....|.|..|: .:..|    |..|.:.||..|...|:|:||.|.|.|   ....| ||.::|..
  Fly   148 ADGDEPRIVNKPEQRGCGITSRQFPRLTGGRPAEPDEWPWMAALLQEG---LPFVW-CGGVLITD 208

  Fly   144 KFVLTAAHCLETSETKEQRLDPNYDGPKYVVRLGELDYNS-TTDDAQPQDFRVLNYVVHPAYGED 207
            :.|||||||:    .|:.:.|       ..|||||  ||: ..::.:.:|||:.|.|:|..|...
  Fly   209 RHVLTAAHCI----YKKNKED-------IFVRLGE--YNTHMLNETRARDFRIANMVLHIDYNPQ 260

  Fly   208 DDTGSRKNDIAVVELEMEATFSEYVAPACL-PLDGGNEQLQVAAAGWGATSESGHASSHLLKVSL 271
                :..||||:|.::....|:.|:.|.|: |::...........|||.....|..|:.|::|:|
  Fly   261 ----NYDNDIAIVRIDRATIFNTYIWPVCMPPVNEDWSDRNAIVTGWGTQKFGGPHSNILMEVNL 321

  Fly   272 DRYDVAEC-SQRLEHKIDVRTQLCAGSRSTSADTCYGDSGGPVFVQHPIYSCLKQVIGITSYGLV 335
            ..:..::| |..::|..|  |.:|||......|:|.||||||:.||.|....:  .|||.|:|:.
  Fly   322 PVWKQSDCRSSFVQHVPD--TAMCAGFPEGGQDSCQGDSGGPLLVQLPNQRWV--TIGIVSWGVG 382

  Fly   336 CGVQGLPSVYTKVHLYTDWI 355
            ||.:|.|.:||:|..|.|||
  Fly   383 CGQRGRPGIYTRVDRYLDWI 402

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4927NP_001033953.1 Tryp_SPc 105..358 CDD:238113 90/254 (35%)
Tryp_SPc 105..355 CDD:214473 88/252 (35%)
CG9372NP_649132.1 CLIP 87..132 CDD:197829 10/48 (21%)
Tryp_SPc 173..402 CDD:214473 88/253 (35%)
Tryp_SPc 176..402 CDD:238113 88/250 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24258
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.