DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4927 and CG32277

DIOPT Version :9

Sequence 1:NP_001033953.1 Gene:CG4927 / 36852 FlyBaseID:FBgn0034139 Length:362 Species:Drosophila melanogaster
Sequence 2:NP_728835.1 Gene:CG32277 / 38393 FlyBaseID:FBgn0052277 Length:261 Species:Drosophila melanogaster


Alignment Length:288 Identity:79/288 - (27%)
Similarity:114/288 - (39%) Gaps:90/288 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   105 IVGGAKAAGREFPFMALLGQRGKNSSQIDWDCGAIIIHPKFVLTAAHCLE---------TSETKE 160
            |.||.....::..|:..|.:.||      :.||.:||.|..|||||||||         |...::
  Fly    27 IFGGKTTLVKDHSFLVNLRRGGK------FRCGGVIISPNCVLTAAHCLEGRYQQVRDLTVHAQQ 85

  Fly   161 QRLDPNYDGPKYVVRLGELDYNSTTDDAQPQDFRVLNYV-VHPAY----GEDDDTGSRKNDIAVV 220
            |.|.                     ||..|:..|...|| :.|.|    |.|       :|:||:
  Fly    86 QCLG---------------------DDMPPEHVRSAWYVGLSPNYCAQRGLD-------SDLAVI 122

  Fly   221 ELEMEATFSEYVAPACLPLD-GGNEQL------------QVAAAGWGATSESGHASSHLL-KVSL 271
            .|..             |.| .||..|            .:...||||.:|.||..:..| :.::
  Fly   123 RLSR-------------PFDIAGNASLVKIDYNDLPPHSNLTVLGWGAINEQGHNWNQCLQEANV 174

  Fly   272 DRYDVAECSQRLE---HKIDVRTQLCAGSRSTSADTCYGDSGGPVFVQHPIYSCLKQVIGITSYG 333
            ......||.:.:.   .|: .....||..:: :.|.|.||||||.     ||:  .:.:||.|:|
  Fly   175 KLISHRECIKSVGSGWQKV-TNNMFCALGKN-ARDACQGDSGGPA-----IYA--GRSVGIVSWG 230

  Fly   334 LVCGVQGLPSVYTKVH--LYTDWIENIV 359
            ..|| .|.|.|||::.  ..|.|:::.:
  Fly   231 YGCG-SGYPGVYTRLSSPSITYWLKDFI 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4927NP_001033953.1 Tryp_SPc 105..358 CDD:238113 79/285 (28%)
Tryp_SPc 105..355 CDD:214473 78/282 (28%)
CG32277NP_728835.1 Tryp_SPc 26..246 CDD:214473 77/275 (28%)
Tryp_SPc 27..246 CDD:238113 77/275 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456083
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.