DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4927 and CG13527

DIOPT Version :9

Sequence 1:NP_001033953.1 Gene:CG4927 / 36852 FlyBaseID:FBgn0034139 Length:362 Species:Drosophila melanogaster
Sequence 2:NP_001286744.1 Gene:CG13527 / 37615 FlyBaseID:FBgn0034776 Length:292 Species:Drosophila melanogaster


Alignment Length:233 Identity:56/233 - (24%)
Similarity:97/233 - (41%) Gaps:34/233 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   136 CGAIIIHPKFVLTAAHCLETSETKEQRLDPNYDGPKYVVRLG---ELDYNSTTDDAQPQD--FRV 195
            ||..::..::|:|||||: ..::|..     |.....:|..|   .|.|........|..  :..
  Fly    62 CGGGLLSNQWVITAAHCV-MGQSKIM-----YKARWLLVVAGSPHRLRYTPGKSVCSPVSSLYVP 120

  Fly   196 LNYVVHPAYGEDDDTGSRKNDIAVVELEMEATFSE-YVAPACLPLDGGNEQLQVAAAGWGATSES 259
            .|:.:|..:           ::|:::|:.:...:: .:....||.:.....::....|||.....
  Fly   121 KNFTMHNTF-----------NMALMKLQEKMPSNDPRIGFLHLPKEAPKIGIRHTVLGWGRMYFG 174

  Fly   260 GHASSHLLKVSLDRYDVAECSQRLEHKIDVRTQLCAGSR--STSADTCYGDSGGPVFVQHPIYSC 322
            |..:.|:.:|.:...|.|.|.....|..|  ..:|||:.  :..|:.|.||.|.|:...      
  Fly   175 GPLAVHIYQVDVVLMDNAVCKTYFRHYGD--GMMCAGNNNWTIDAEPCSGDIGSPLLSG------ 231

  Fly   323 LKQVIGITSYGLVCGVQGLPSVYTKVHLYTDWIENIVW 360
             |.|:||.:|.:.||...:|||||.|.....||.:..:
  Fly   232 -KVVVGIVAYPIGCGCTNIPSVYTDVFSGLRWIRHTAY 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4927NP_001033953.1 Tryp_SPc 105..358 CDD:238113 56/229 (24%)
Tryp_SPc 105..355 CDD:214473 54/226 (24%)
CG13527NP_001286744.1 Tryp_SPc 43..266 CDD:238113 56/229 (24%)
Tryp_SPc 43..263 CDD:214473 54/226 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456050
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.