DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4927 and psh

DIOPT Version :9

Sequence 1:NP_001033953.1 Gene:CG4927 / 36852 FlyBaseID:FBgn0034139 Length:362 Species:Drosophila melanogaster
Sequence 2:NP_573297.1 Gene:psh / 32832 FlyBaseID:FBgn0030926 Length:394 Species:Drosophila melanogaster


Alignment Length:288 Identity:93/288 - (32%)
Similarity:139/288 - (48%) Gaps:38/288 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    87 KECRRFNEIRTSCRTTPFIVGGAKAAGREFPFMALLGQRGKNSSQIDWDCGAIIIHPKFVLTAAH 151
            |:.|...:.|:..:....||||.......:|.||.:|.   .:...|:.||..:|..:|||||||
  Fly   126 KKIRERKQQRSGNQLVIHIVGGYPVDPGVYPHMAAIGY---ITFGTDFRCGGSLIASRFVLTAAH 187

  Fly   152 CLETSETKEQRLDPNYDGPKYVVRLGELDYNSTTDDAQPQDFRVLNYVVHPAYGEDDDTGSRKND 216
            |:.|        |.|  .|.: ||||.:  |....|...||..:.:..:||.|     .|::.||
  Fly   188 CVNT--------DAN--TPAF-VRLGAV--NIENPDHSYQDIVIRSVKIHPQY-----VGNKYND 234

  Fly   217 IAVVELEMEATFSEYVAPACLPLDG----GNEQLQVAAAGWGATSESGHASSHLL------KVSL 271
            ||::|||.:...::.:.||||..|.    .|.:..|  ||||..:.:..|.|.:|      .|.|
  Fly   235 IAILELERDVVETDNIRPACLHTDATDPPSNSKFFV--AGWGVLNVTTRARSKILLRAGLELVPL 297

  Fly   272 DRYDVAECSQ----RLEHKIDVRTQLCAGSRSTSADTCYGDSGGPVFVQHPIYSCLKQVIGITSY 332
            |:.:::...|    ||..:..:.:.|||..:...||.|.||||||:..:..:...:..::|:.|.
  Fly   298 DQCNISYAEQPGSIRLLKQGVIDSLLCAIDQKLIADACKGDSGGPLIHELNVEDGMYTIMGVISS 362

  Fly   333 GLVCGVQGLPSVYTKVHLYTDWIENIVW 360
            |..|... .|.:||:|..|.|:||.|||
  Fly   363 GFGCATV-TPGLYTRVSSYLDFIEGIVW 389

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4927NP_001033953.1 Tryp_SPc 105..358 CDD:238113 87/266 (33%)
Tryp_SPc 105..355 CDD:214473 85/263 (32%)
pshNP_573297.1 CLIP 30..79 CDD:197829
Tryp_SPc 143..384 CDD:214473 85/264 (32%)
Tryp_SPc 144..387 CDD:238113 87/266 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D105391at6960
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.