DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4927 and Ser7

DIOPT Version :9

Sequence 1:NP_001033953.1 Gene:CG4927 / 36852 FlyBaseID:FBgn0034139 Length:362 Species:Drosophila melanogaster
Sequence 2:NP_572582.1 Gene:Ser7 / 31917 FlyBaseID:FBgn0019929 Length:397 Species:Drosophila melanogaster


Alignment Length:420 Identity:104/420 - (24%)
Similarity:165/420 - (39%) Gaps:95/420 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 ILLILAVICSIL----SEF---------CDN---GTGECKELSATDCPSIFFNLHLIRNFVKYCD 55
            :||::.:..::|    .:|         |::   |.|.|  :...||     :.:.:...::...
  Fly     1 MLLLIPLFLTLLGAEAQQFGKAIMHFGNCNSVEFGRGTC--IEKKDC-----DFYAVDKLMELAS 58

  Fly    56 KSN-------HIVCCLLPNNMQPQSQQFSANIGLRRFEKECRRFNEIRTSCRTTP---------- 103
            |..       .:|||....|:.|......:| |........   ..::...||||          
  Fly    59 KQQCFSRQRPDLVCCPRETNIIPPLAPRISN-GTTNATSST---TTLKLLPRTTPRPPSGIDQLP 119

  Fly   104 -----------FIVGGAKAAGREFPFMALLGQRGKNSSQIDWDCGAIIIHPKFVLTAAHCLETSE 157
                       .:|||......|||:..||.....:..: |:.|||..|..:::||||||:.|..
  Fly   120 EHPYCGSAFSFRLVGGHNTGLFEFPWTTLLEYETVSGGK-DYACGASFIAQRWLLTAAHCIHTMG 183

  Fly   158 TK---------EQRLDPNYDGPKYVVRLGELDYNSTTDDAQPQDFRVLNYVV-HPAYGEDDDTGS 212
            ..         .:..||:.          |.|.|...:.|.|.....::.:: |..|.|    .:
  Fly   184 RNLTAAILGEWNRDTDPDC----------ENDLNGVRECAPPHIRVTIDRILPHAQYSE----LN 234

  Fly   213 RKNDIAVVELEMEATF--SEYVAPACLPLDGGNEQLQVA-----AAGWGATSESGHASSHLLKVS 270
            .:||||::.|.....:  .:.:.|.|||...|....|:|     .:|||.|..|| :|....|..
  Fly   235 YRNDIALLRLSRPVNWLQMQNLEPVCLPPQRGRYANQLAGSAADVSGWGKTESSG-SSKIKQKAM 298

  Fly   271 LDRYDVAECSQRL--EHKIDVR-TQLCAGSRSTSADTCYGDSGGPVFVQHPIYSCLKQV--IGIT 330
            |......:|.:..  :.||.:. :|:|||. ....|:|.||||||:.|:....|..:.|  .|:.
  Fly   299 LHIQPQDQCQEAFYKDTKITLADSQMCAGG-EIGVDSCSGDSGGPLTVEANTASGNRYVYLAGVV 362

  Fly   331 SYGLV-CGVQGLPSVYTKVHLYTDWIENIV 359
            |.|.. ||......:||:|..|.||||:.:
  Fly   363 SIGRKHCGTALFSGIYTRVSSYMDWIESTI 392

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4927NP_001033953.1 Tryp_SPc 105..358 CDD:238113 82/275 (30%)
Tryp_SPc 105..355 CDD:214473 79/272 (29%)
Ser7NP_572582.1 CLIP 29..74 CDD:197829 9/51 (18%)
Tryp_SPc 131..388 CDD:214473 79/273 (29%)
Tryp_SPc 133..391 CDD:238113 82/274 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455927
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24258
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.