DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4927 and CG32260

DIOPT Version :9

Sequence 1:NP_001033953.1 Gene:CG4927 / 36852 FlyBaseID:FBgn0034139 Length:362 Species:Drosophila melanogaster
Sequence 2:NP_728942.1 Gene:CG32260 / 317943 FlyBaseID:FBgn0052260 Length:575 Species:Drosophila melanogaster


Alignment Length:399 Identity:101/399 - (25%)
Similarity:151/399 - (37%) Gaps:100/399 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 GECKELSATDCPSIF---------FNLHLIRNFVKYCDKSNHIVCCLLPNNMQPQSQQ-----FS 77
            |.|  |..|.||.:.         |:..|.::...: |.|..:|||....:...:|::     .:
  Fly   202 GSC--LPLTSCPQLMQEYQGQANEFHTFLGQSICGF-DGSTFMVCCATDRSGNARSRKDVFVTTA 263

  Fly    78 ANIGLRRF-------------------------------------EKECRRFNEIRTSCRTTPFI 105
            |..|...|                                     ....|.......|..|:..:
  Fly   264 APFGFFHFSPLSGGSTATPMVFQPTPPLSQVVSPSFYPPPPPPPPNNAPRESATCGISGATSNRV 328

  Fly   106 VGGAKAAGREFPFMALLGQ-RGKNSSQIDWDCGAIIIHPKFVLTAAHCLETSETKEQRLDPNYDG 169
            |||.:|....:|::|.||. ...|.:.:.:.||..:||.::|:|:|||:....|           
  Fly   329 VGGMEARKGAYPWIAALGYFEENNRNALKFLCGGSLIHSRYVITSAHCINPMLT----------- 382

  Fly   170 PKYVVRLGELDYNSTTDDAQPQDFRVLNYVVHPAYGEDDDTGSRKNDIAVVELEMEATFSEYVAP 234
               :||||..|.:...:.. ..|.|:...|||    |..|..|..||||::||.:.......::|
  Fly   383 ---LVRLGAHDLSQPAESG-AMDLRIRRTVVH----EHFDLNSISNDIALIELNVVGALPGNISP 439

  Fly   235 ACLPLDGGNEQ-----LQVAAAGWGATSESGHASSHLLKVSLDRYDVAECSQ---------RLEH 285
            .|||......|     :....|||||....|..|..|....:.......|.|         :...
  Fly   440 ICLPEAAKFMQQDFVGMNPFVAGWGAVKHQGVTSQVLRDAQVPIVSRHSCEQSYKSIFQFVQFSD 504

  Fly   286 KIDVRTQLCAGSRSTSADTCYGDSGGPVF---VQHPIYSCLKQVIGITSYGLVCGVQGLPSVYTK 347
            |:     ||||  |:|.|.|.||||||:.   ::..:|..  .::|:.|:|..|.....|.|||:
  Fly   505 KV-----LCAG--SSSVDACQGDSGGPLMMPQLEGNVYRF--YLLGLVSFGYECARPNFPGVYTR 560

  Fly   348 VHLYTDWIE 356
            |..|..||:
  Fly   561 VASYVPWIK 569

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4927NP_001033953.1 Tryp_SPc 105..358 CDD:238113 81/270 (30%)
Tryp_SPc 105..355 CDD:214473 79/267 (30%)
CG32260NP_728942.1 CLIP 194..244 CDD:288855 11/44 (25%)
Tryp_SPc 327..568 CDD:214473 79/268 (29%)
Tryp_SPc 328..571 CDD:238113 81/270 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456085
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24258
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.