DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4927 and CG1632

DIOPT Version :9

Sequence 1:NP_001033953.1 Gene:CG4927 / 36852 FlyBaseID:FBgn0034139 Length:362 Species:Drosophila melanogaster
Sequence 2:NP_001245577.1 Gene:CG1632 / 31763 FlyBaseID:FBgn0030027 Length:1056 Species:Drosophila melanogaster


Alignment Length:225 Identity:50/225 - (22%)
Similarity:75/225 - (33%) Gaps:67/225 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   148 TAAHCLETSETKEQRLDPNYDGPKYVVRLGELDYNSTTDDAQPQDFRVLNYVVHPAYGEDDDTGS 212
            :||..:..:|...|.|| .|..|                |..||    :||....:......|.:
  Fly   883 SAASYMPKAEALHQELD-GYPLP----------------DHAPQ----VNYYSSSSTVTSSSTAA 926

  Fly   213 RKNDIAVVELEMEATFSEYVAPACLPLDGGNEQL--QVAAAGWGATSESGHASSHLLKVSLDRYD 275
            |   ||.            .||....:....||:  .....||....:      ||.:|.|...|
  Fly   927 R---IAT------------KAPILAAVPAAQEQIWTNCNTLGWSRQRD------HLQRVQLKMGD 970

  Fly   276 VAECSQRLEHKIDVRT--QLCAGSRSTSADTCYGD-SGGPVFVQHPIYSCL------KQVIGITS 331
            :|.|     ..:.:.|  .:|..:.....|....: ||.||       .||      ..:||::|
  Fly   971 MAPC-----ENVSIATVNSMCMEATYQKYDCTQEEYSGAPV-------QCLIPGTNQWALIGVSS 1023

  Fly   332 YGLVCGVQGL--PSVYTKVHLYTDWIENIV 359
            :.:.||..|:  |.:|.|:.....||...:
  Fly  1024 WRIACGPTGVERPRMYDKIASNAAWIRETI 1053

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4927NP_001033953.1 Tryp_SPc 105..358 CDD:238113 50/222 (23%)
Tryp_SPc 105..355 CDD:214473 48/219 (22%)
CG1632NP_001245577.1 SEA 232..327 CDD:279699
CRD_FZ 384..502 CDD:143549
PRKCSH-like <503..>582 CDD:193472
LDLa 536..571 CDD:238060
Tryp_SPc 708..>809 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24258
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.