DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4927 and GZMA

DIOPT Version :9

Sequence 1:NP_001033953.1 Gene:CG4927 / 36852 FlyBaseID:FBgn0034139 Length:362 Species:Drosophila melanogaster
Sequence 2:NP_006135.2 Gene:GZMA / 3001 HGNCID:4708 Length:262 Species:Homo sapiens


Alignment Length:261 Identity:75/261 - (28%)
Similarity:111/261 - (42%) Gaps:45/261 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   105 IVGGAKAAGREFPFMALLGQRGKNSSQIDWDCGAIIIHPKFVLTAAHCLETSETKEQRLDPNYDG 169
            |:||.:......|:|.||....|..      |...:|...:|||||||             |.:.
Human    29 IIGGNEVTPHSRPYMVLLSLDRKTI------CAGALIAKDWVLTAAHC-------------NLNK 74

  Fly   170 PKYVVRLGELDYNSTTDDAQPQDFRVLNYVVHPAYGEDDDTGSRKNDIAVVELEMEATFSEYVAP 234
            ...|: ||.  ::.|.::...|...|.....:|.|    |..:|:.|:.:::|..:|..::||..
Human    75 RSQVI-LGA--HSITREEPTKQIMLVKKEFPYPCY----DPATREGDLKLLQLMEKAKINKYVTI 132

  Fly   235 ACLPLDGGNEQ--LQVAAAGWGATSESGHASSHLLKVSLDRYDVAECSQRLEHKIDV---RTQLC 294
            ..||..|.:.:  .....||||.|..|...|..|.:|::...|...|:.|..:..:.   ...:|
Human   133 LHLPKKGDDVKPGTMCQVAGWGRTHNSASWSDTLREVNITIIDRKVCNDRNHYNFNPVIGMNMVC 197

  Fly   295 AGSRSTSADTCYGDSGGPVFVQHPIYSCLKQVIGITSYGL--VCGVQGLPSVY---TKVHLYTDW 354
            |||.....|:|.||||.|:.       |.....|:||:||  .||....|.||   :|.||  :|
Human   198 AGSLRGGRDSCNGDSGSPLL-------CEGVFRGVTSFGLENKCGDPRGPGVYILLSKKHL--NW 253

  Fly   355 I 355
            |
Human   254 I 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4927NP_001033953.1 Tryp_SPc 105..358 CDD:238113 75/261 (29%)
Tryp_SPc 105..355 CDD:214473 73/259 (28%)
GZMANP_006135.2 Tryp_SPc 29..254 CDD:238113 73/259 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D476534at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.