DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4927 and Sp212

DIOPT Version :9

Sequence 1:NP_001033953.1 Gene:CG4927 / 36852 FlyBaseID:FBgn0034139 Length:362 Species:Drosophila melanogaster
Sequence 2:NP_996209.2 Gene:Sp212 / 2768666 FlyBaseID:FBgn0053329 Length:516 Species:Drosophila melanogaster


Alignment Length:304 Identity:81/304 - (26%)
Similarity:122/304 - (40%) Gaps:55/304 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 PNNMQPQSQQFSANIGLRRFEKECRRFNEIRTSCRTTPFIVGGAKAAGREFPFMALLGQRGKNSS 130
            |....|:||..|.         .|.|...      ||||||.|.:....::|:::.:..  |...
  Fly   253 PQRFDPRSQISSV---------VCGREGS------TTPFIVRGNEFPRGQYPWLSAVYH--KEVR 300

  Fly   131 QIDWDCGAIIIHPKFVLTAAHCLETSETKEQRLDPNYDGPKYVVRLGELDYNSTTDDAQPQDFRV 195
            .:.:.|...:|....|::||||:.  ...|.|:         ||.||..|.:...:|..... .|
  Fly   301 ALAFKCRGSLISSSIVISAAHCVH--RMTEDRV---------VVGLGRYDLDDYGEDGAEMR-NV 353

  Fly   196 LNYVVHPAYGEDDDTGSRKN-DIAVVELEMEATFSEYVAPACLPLDGGNEQLQVAA--AGWGATS 257
            :..:.||.|    :|.|..: |||::.:|...||::.:||.|:.....:..:....  ||||...
  Fly   354 MRLLWHPDY----NTRSYSDADIALITIERPVTFNDIIAPICMWTVEASRTVSTTGFIAGWGRDE 414

  Fly   258 ESGHASSHLLKVSLDRYDVAE------CSQRLEHKIDVRTQLCAGSRSTSADTCYGDSGGPVFVQ 316
            :|.       :....|...||      |:......:.....||||:|..|. .|.|||||.:.|:
  Fly   415 DSS-------RTQYPRVVEAEIASPTVCASTWRGTMVTERSLCAGNRDGSG-PCVGDSGGGLMVK 471

  Fly   317 HPIYSCLKQVIGITSYGLVCGVQGLPSVYTKVHLYTDWIENIVW 360
            ......|:   ||.|.| ..|..|...:...| ||.|..::|.|
  Fly   472 QGDRWLLR---GIVSAG-ERGPAGTCQLNQYV-LYCDLSKHINW 510

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4927NP_001033953.1 Tryp_SPc 105..358 CDD:238113 68/261 (26%)
Tryp_SPc 105..355 CDD:214473 68/258 (26%)
Sp212NP_996209.2 GD_N 23..122 CDD:292649
Tryp_SPc 277..514 CDD:238113 70/265 (26%)
Tryp_SPc 277..511 CDD:214473 70/265 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24258
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.