DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4927 and Gzma

DIOPT Version :9

Sequence 1:NP_001033953.1 Gene:CG4927 / 36852 FlyBaseID:FBgn0034139 Length:362 Species:Drosophila melanogaster
Sequence 2:NP_703198.1 Gene:Gzma / 266708 RGDID:628640 Length:261 Species:Rattus norvegicus


Alignment Length:267 Identity:74/267 - (27%)
Similarity:111/267 - (41%) Gaps:46/267 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   105 IVGGAKAAGREFPFMALLGQRGKNSSQIDWDCGAIIIHPKFVLTAAHCLETSETKEQRLDPNYDG 169
            |:||........|:|.||      ..:.|..|...:|...:|||||||:              .|
  Rat    29 IIGGDTVVPHSRPYMVLL------KLKPDSICAGALIAKNWVLTAAHCI--------------PG 73

  Fly   170 PKYVVRLGELDYNSTTDDAQPQDFRVLNYVVHPAYGEDDDTGSRKNDIAVVELEMEATFSEYVAP 234
            .|..|.||.   :|...:.:.|...|.....:|.:    |..:.:.|:.::.|:.:||.::.||.
  Rat    74 KKSEVILGA---HSIKKEPEQQILSVKKAYPYPCF----DKHTHEGDLQLLRLKKKATLNKNVAI 131

  Fly   235 ACLPLDGGNEQ--LQVAAAGWGATSESGHASSHLLKVSLDRYDVAECSQRLEHKIDV---RTQLC 294
            ..||..|.:.:  .:...||||........|..|.:|::...|...|:....:..:.   ...:|
  Rat   132 LHLPKKGDDVKPGTRCHVAGWGRFHNKSPPSDTLREVNITVIDRKICNDEKHYNFNPVIGLNMIC 196

  Fly   295 AGSRSTSADTCYGDSGGPVFVQHPIYSCLKQVIGITSYGLV--CGVQGLPSVYTKV---HLYTDW 354
            ||:.....|:||||||||:.       |.....|||::||.  ||....|.:||.:   ||  ||
  Rat   197 AGNLRGGKDSCYGDSGGPLL-------CEGIFRGITAFGLEGRCGDPKGPGIYTLLSDKHL--DW 252

  Fly   355 IENIVWG 361
            |.....|
  Rat   253 IRKTAKG 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4927NP_001033953.1 Tryp_SPc 105..358 CDD:238113 73/262 (28%)
Tryp_SPc 105..355 CDD:214473 71/259 (27%)
GzmaNP_703198.1 Tryp_SPc 28..253 CDD:214473 71/259 (27%)
Tryp_SPc 29..256 CDD:238113 73/262 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D476534at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.